StarFunc result for job id P20916

User Input

>input (626 residues)
MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWY
FNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGD
LGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGL
GEPAVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQASFPNTTLQFEGYASMDVKYPP
VIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGTVLREAVAESLLLELEEVTPAED
GVYACLAENAYGQDNRTVGLSVMYAPWKPTVNGTMVAVEGETVSILCSTQSNPDPILTIF
KEKQILSTVIYESELQLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPVLLLESH
CAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNESEREFVYSERSGLVLTSILTLRGQA
QAPPRVICTARNLYGAKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKK
NVTESPSFSAGDNPPVLFSSDFRISGAPEKYESERRLGSERRLLGLRGEPPELDLSYSHS
DLGKRPTKDSYTLTEELAEYAEIRVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20917	0.835	0.834	4.596E-101	627	0.944	0.943	P20917.pdb.gz	MAG_MOUSE Myelin-associated glycoprotein OS=Mus musculus OX=10090 GN=Mag PE=1 SV=3
2	AFDB:F1QSA4	0.737	0.708	2.834E-62	653	0.374	0.358	F1QSA4.pdb.gz	F1QSA4_DANRE Myelin-associated glycoprotein OS=Danio rerio OX=7955 GN=siglec-4 PE=1 SV=1
3	AFDB:Q7TSU7	0.376	0.345	3.486E-31	700	0.220	0.197	Q7TSU7.pdb.gz	KIRR2_MOUSE Kin of IRRE-like protein 2 OS=Mus musculus OX=10090 GN=Kirrel2 PE=1 SV=1
4	AFDB:P20273	0.322	0.253	1.930E-30	847	0.252	0.187	P20273.pdb.gz	CD22_HUMAN B-cell receptor CD22 OS=Homo sapiens OX=9606 GN=CD22 PE=1 SV=2
5	AFDB:Q6NY23	0.399	0.325	3.255E-30	807	0.193	0.150	Q6NY23.pdb.gz	Q6NY23_DANRE Kin of IRRE like (Drosophila) OS=Danio rerio OX=7955 GN=kirrel PE=1 SV=1
6	AFDB:Q6UWL6	0.361	0.329	3.580E-30	708	0.217	0.192	Q6UWL6.pdb.gz	KIRR2_HUMAN Kin of IRRE-like protein 2 OS=Homo sapiens OX=9606 GN=KIRREL2 PE=1 SV=3
7	AFDB:Q08180	0.343	0.294	8.423E-30	764	0.195	0.160	Q08180.pdb.gz	ICCR_DROME Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2
8	AFDB:B3DHL7	0.385	0.317	9.263E-30	790	0.195	0.154	B3DHL7.pdb.gz	B3DHL7_DANRE Kirre like nephrin family adhesion molecule 1b precursor OS=Danio rerio OX=7955 GN=si:ch211-195h23.2 PE=2 SV=1
9	AFDB:O15389	0.209	0.234	1.068E-29	551	0.217	0.247	O15389.pdb.gz	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
10	AFDB:B0CM22	0.407	0.345	1.982E-29	769	0.193	0.157	B0CM22.pdb.gz
11	PDB:5oj2B	0.229	0.211	1.447E-19	692	0.163	0.147	5oj2B.pdb.gz
12	PDB:1e07A	0.300	0.295	4.461E-16	642	0.129	0.126	1e07A.pdb.gz
13	PDB:6dldD	0.234	0.519	1.698E-13	269	0.101	0.234	6dldD.pdb.gz
14	PDB:2rcjC	0.186	0.204	3.809E-13	523	0.137	0.164	2rcjC.pdb.gz
15	PDB:4rtdA	0.169	0.105	7.772E-13	1122	0.099	0.055	4rtdA.pdb.gz
16	PDB:7sqcO0	0.215	0.139	1.192E-12	1140	0.109	0.060	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:5a42A	0.158	0.078	3.912E-12	1597	0.109	0.043	5a42A.pdb.gz
18	PDB:4ziqA	0.130	0.071	1.628E-11	1450	0.110	0.048	4ziqA.pdb.gz
19	PDB:6dlfA	0.235	0.545	1.628E-11	236	0.081	0.216	6dlfA.pdb.gz
20	PDB:7q5zA	0.164	0.099	3.484E-11	1344	0.089	0.042	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07722	0.0	1242	626	0.954	0.954	MAG_RAT Myelin-associated glycoprotein OS=Rattus norvegicus OX=10116 GN=Mag PE=1 SV=1
2	P20916	0.0	1283	626	1.000	1.000	MAG_HUMAN Myelin-associated glycoprotein OS=Homo sapiens OX=9606 GN=MAG PE=1 SV=1
3	P20917	0.0	1225	627	0.944	0.943	MAG_MOUSE Myelin-associated glycoprotein OS=Mus musculus OX=10090 GN=Mag PE=1 SV=3
4	A0A0R4IQ16	9.36e-157	466	635	0.366	0.361	A0A0R4IQ16_DANRE Myelin-associated glycoprotein OS=Danio rerio OX=7955 GN=siglec-4 PE=1 SV=1
5	F1QSA4	1.08e-156	467	653	0.366	0.351	F1QSA4_DANRE Myelin-associated glycoprotein OS=Danio rerio OX=7955 GN=siglec-4 PE=1 SV=1
6	Q96LC7	1.03e-49	186	697	0.264	0.237	SIG10_HUMAN Sialic acid-binding Ig-like lectin 10 OS=Homo sapiens OX=9606 GN=SIGLEC10 PE=1 SV=3
7	Q80ZE3	4.96e-48	181	688	0.254	0.231	SIG10_MOUSE Sialic acid-binding Ig-like lectin 10 OS=Mus musculus OX=10090 GN=Siglec10 PE=1 SV=1
8	Q96RL6	5.85e-44	169	698	0.225	0.202	SIG11_HUMAN Sialic acid-binding Ig-like lectin 11 OS=Homo sapiens OX=9606 GN=SIGLEC11 PE=1 SV=2
9	J9S2W1	3.44e-36	148	1730	0.227	0.082	J9S2W1_PIG Sialoadhesin OS=Sus scrofa OX=9823 PE=2 SV=1
10	J9T303	3.70e-36	148	1730	0.227	0.082	J9T303_PIG Sialoadhesin OS=Sus scrofa OX=9823 PE=2 SV=1
11	A7LCJ3	2.78e-35	145	1730	0.174	0.063	SN_PIG Sialoadhesin OS=Sus scrofa OX=9823 GN=SIGLEC1 PE=1 SV=1
12	A6NMB1	9.28e-33	134	481	0.179	0.233	SIG16_HUMAN Sialic acid-binding Ig-like lectin 16 OS=Homo sapiens OX=9606 GN=SIGLEC16 PE=2 SV=3
13	Q62230	5.74e-31	132	1695	0.200	0.074	SN_MOUSE Sialoadhesin OS=Mus musculus OX=10090 GN=Siglec1 PE=1 SV=2
14	Q920G3	3.00e-28	121	569	0.163	0.179	SIGL5_MOUSE Sialic acid-binding Ig-like lectin 5 OS=Mus musculus OX=10090 GN=Siglec5 PE=2 SV=1
15	Q9Y286	3.06e-28	120	467	0.139	0.186	SIGL7_HUMAN Sialic acid-binding Ig-like lectin 7 OS=Homo sapiens OX=9606 GN=SIGLEC7 PE=1 SV=1
16	Q9NYZ4	3.64e-28	120	499	0.141	0.176	SIGL8_HUMAN Sialic acid-binding Ig-like lectin 8 OS=Homo sapiens OX=9606 GN=SIGLEC8 PE=1 SV=2
17	O15389	1.04e-26	117	551	0.181	0.205	SIGL5_HUMAN Sialic acid-binding Ig-like lectin 5 OS=Homo sapiens OX=9606 GN=SIGLEC5 PE=1 SV=1
18	Q96PQ1	2.15e-26	116	595	0.136	0.143	SIG12_HUMAN Sialic acid-binding Ig-like lectin 12 OS=Homo sapiens OX=9606 GN=SIGLEC12 PE=1 SV=1
19	Q9Y336	2.91e-26	114	463	0.141	0.190	SIGL9_HUMAN Sialic acid-binding Ig-like lectin 9 OS=Homo sapiens OX=9606 GN=SIGLEC9 PE=1 SV=2
20	O43699	4.44e-26	114	453	0.161	0.223	SIGL6_HUMAN Sialic acid-binding Ig-like lectin 6 OS=Homo sapiens OX=9606 GN=SIGLEC6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	3.8e-10	51.0	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	6.3e-18	76.0	Immunoglobulin I-set domain
3	PF00047 ig	6.4e-10	50.4	Immunoglobulin domain
4	PF13895 Ig_2	2.8e-19	80.5	Immunoglobulin domain
5	PF13927 Ig_3	1.1e-28	110.9	Immunoglobulin domain
6	PF16680 Ig_4	16	17.5	T-cell surface glycoprotein CD3 delta chain
7	PF16681 Ig_5	0.00058	31.6	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF17736 Ig_C17orf99	10	17.6	C17orf99 Ig domain
9	PF16706 Izumo-Ig	35	15.7	Izumo-like Immunoglobulin domain
10	PF07686 V-set	3.4e-12	57.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376048

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000043402	0.997	Reticulon-4 receptor
2	9606.ENSP00000347451	0.982	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
3	9606.ENSP00000247271	0.977	Oligodendrocyte-myelin glycoprotein
4	9606.ENSP00000172229	0.969	Tumor necrosis factor receptor superfamily member 16
5	9606.ENSP00000337838	0.969	Reticulon-4
6	9606.ENSP00000380093	0.968	Transcription factor SOX-10
7	9606.ENSP00000242480	0.949	E3 SUMO-protein ligase EGR2
8	9606.ENSP00000380958	0.941	Myelin basic protein
9	9606.ENSP00000384582	0.920	G-protein coupled receptor 98
10	9606.ENSP00000481006	0.911	Myelin proteolipid protein
11	9606.ENSP00000376297	0.898	Dynein light chain 1, cytoplasmic
12	9606.ENSP00000484824	0.891	Mucin-1
13	9606.ENSP00000335397	0.868	Reticulon-4 receptor-like 2
14	9606.ENSP00000360214	0.864	Opalin
15	9606.ENSP00000366095	0.858	Myelin-oligodendrocyte glycoprotein
16	9606.ENSP00000400175	0.819	Transforming protein RhoA
17	9606.ENSP00000377470	0.802	2',3'-cyclic-nucleotide 3'-phosphodiesterase
18	9606.ENSP00000346671	0.779	Tyrosine-protein kinase Fyn
19	9606.ENSP00000468500	0.759	Glial fibrillary acidic protein
20	9606.ENSP00000331040	0.756	Oligodendrocyte transcription factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008289	0.998	lipid binding
GO:0033691	0.998	sialic acid binding
GO:0042802	0.987	identical protein binding
GO:0051861	0.904	glycolipid binding
GO:0046625	0.903	sphingolipid binding
GO:0043208	0.891	glycosphingolipid binding
GO:0097001	0.650	ceramide binding
GO:0046983	0.633	protein dimerization activity
GO:0042803	0.542	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.986	regulation of biological process
GO:0007399	0.984	nervous system development
GO:0050794	0.982	regulation of cellular process
GO:0007417	0.951	central nervous system development
GO:0050896	0.948	response to stimulus
GO:0071840	0.939	cellular component organization or biogenesis
GO:0016043	0.929	cellular component organization
GO:0048857	0.842	neural nucleus development
GO:0051716	0.790	cellular response to stimulus
GO:0030901	0.790	midbrain development
GO:0048519	0.774	negative regulation of biological process
GO:0051128	0.771	regulation of cellular component organization
GO:0050793	0.766	regulation of developmental process
GO:0048523	0.662	negative regulation of cellular process
GO:0051239	0.637	regulation of multicellular organismal process
GO:0048869	0.632	cellular developmental process
GO:0048518	0.627	positive regulation of biological process
GO:0030154	0.623	cell differentiation
GO:0045685	0.620	regulation of glial cell differentiation
GO:0022008	0.541	neurogenesis
GO:0031344	0.535	regulation of cell projection organization
GO:0007154	0.515	cell communication
GO:0051960	0.499	regulation of nervous system development
GO:0007272	0.486	ensheathment of neurons
GO:0065008	0.475	regulation of biological quality
GO:0008366	0.450	axon ensheathment
GO:0010975	0.402	regulation of neuron projection development
GO:0048522	0.383	positive regulation of cellular process
GO:0032291	0.366	axon ensheathment in central nervous system
GO:0030030	0.349	cell projection organization
GO:0010977	0.335	negative regulation of neuron projection development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.942	intracellular anatomical structure
GO:0043218	0.884	compact myelin
GO:0005737	0.835	cytoplasm
GO:0043226	0.636	organelle
GO:0043227	0.615	membrane-bounded organelle
GO:0043229	0.586	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]