StarFunc result for job id P20930

User Input

>input (1400 residues)
MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDH
LDIDHNKKIDFTEFLLMVFKLAQAYYESTRKENLPISGHKHRKHSHHDKHEDNKQEENKE
NRKRPSSLERRNNRKGNKGRSKSPRETGGKRHESSSEKKERKGYSPTHREEEYGKNHHNS
SKKEKNKTENTRLGDNRKRLSERLEEKEDNEEGVYDYENTGRMTQKWIQSGHIATYYTIQ
DEAYDTTDSLLEENKIYERSRSSDGKSSSQVNRSRHENTSQVPLQESRTRKRRGSRVSQD
RDSEGHSEDSERHSGSASRNHHGSAWEQSRDGSRHPRSHDEDRASHGHSADSSRQSGTRH
AETSSRGQTASSHEQARSSPGERHGSGHQQSADSSRHSATGRGQASSAVSDRGHRGSSGS
QASDSEGHSENSDTQSVSGHGKAGLRQQSHQESTRGRSGERSGRSGSSLYQVSTHEQPDS
AHGRTGTSTGGRQGSHHEQARDSSRHSASQEGQDTIRGHPGSSRGGRQGSHHEQSVNRSG
HSGSHHSHTTSQGRSDASHGQSGSRSASRQTRNEEQSGDGTRHSGSRHHEASSQADSSRH
SQVGQGQSSGPRTSRNQGSSVSQDSDSQGHSEDSERWSGSASRNHHGSAQEQSRDGSRHP
RSHHEDRAGHGHSADSSRKSGTRHTQNSSSGQAASSHEQARSSAGERHGSRHQLQSADSS
RHSGTGHGQASSAVRDSGHRGSSGSQATDSEGHSEDSDTQSVSGHGQAGHHQQSHQESAR
DRSGERSRRSGSFLYQVSTHKQSESSHGWTGPSTGVRQGSHHEQARDNSRHSASQDGQDT
IRGHPGSSRRGRQGSHHEQSVDRSGHSGSHHSHTTSQGRSDASRGQSGSRSASRTTRNEE
QSRDGSRHSGSRHHEASSHADISRHSQAGQGQSEGSRTSRRQGSSVSQDSDSEGHSEDSE
RWSGSASRNHRGSAQEQSRHGSRHPRSHHEDRAGHGHSADSSRQSGTPHAETSSGGQAAS
SHEQARSSPGERHGSRHQQSADSSRHSGIPRRQASSAVRDSGHWGSSGSQASDSEGHSEE
SDTQSVSGHGQDGPHQQSHQESARDWSGGRSGRSGSFIYQVSTHEQSESAHGRTRTSTGR
RQGSHHEQARDSSRHSASQEGQDTIRAHPGSRRGGRQGSHHEQSVDRSGHSGSHHSHTTS
QGRSDASHGQSGSRSASRQTRKDKQSGDGSRHSGSRHHEAASWADSSRHSQVGQEQSSGS
RTSRHQGSSVSQDSDSERHSDDSERLSGSASRNHHGSSREQSRDGSRHPGFHQEDRASHG
HSADSSRQSGTHHTESSSHGQAVSSHEQARSSPGERHGSRHQQSADSSRHSGIGHRQASS
AVRDSGHRGSSGSQVTNSEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05331	0.087	0.099	2.044E-103	1218	0.749	0.860	Q05331.pdb.gz	Q05331_HUMAN Profilaggrin (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
2	AFDB:Q5D862	0.080	0.052	1.341E-9	2391	0.311	0.182	Q5D862.pdb.gz	FILA2_HUMAN Filaggrin-2 OS=Homo sapiens OX=9606 GN=FLG2 PE=1 SV=1
3	AFDB:Q2VIS4	0.067	0.043	1.985E-9	2362	0.313	0.185	Q2VIS4.pdb.gz	FILA2_MOUSE Filaggrin-2 OS=Mus musculus OX=10090 GN=Flg2 PE=1 SV=2
4	AFDB:Q8VHD8	0.079	0.051	5.940E-8	2496	0.310	0.174	Q8VHD8.pdb.gz	HORN_MOUSE Hornerin OS=Mus musculus OX=10090 GN=Hrnr PE=1 SV=1
5	PDB:6zdyA	0.068	0.809	6.545E-6	108	0.022	0.287	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
6	PDB:1k96A	0.060	0.888	9.688E-6	89	0.019	0.303	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
7	PDB:5csnA	0.064	0.896	1.862E-5	94	0.022	0.330	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
8	PDB:5hloC	0.063	0.864	1.988E-5	93	0.017	0.258	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.
9	PDB:7psqG	0.066	0.751	2.943E-5	108	0.019	0.241	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
10	PDB:2lucA	0.061	0.738	3.354E-5	105	0.023	0.305	2lucA.pdb.gz
11	AFDB:P97347	0.083	0.101	3.838E-5	1118	0.164	0.206	P97347.pdb.gz	RPTN_MOUSE Repetin OS=Mus musculus OX=10090 GN=Rptn PE=2 SV=2
12	PDB:2k2fA	0.060	0.763	5.300E-5	93	0.023	0.344	2k2fA.pdb.gz	S100A1 and Calmodulin Compete for the Same Binding Site on Ryanodine Receptor.
13	PDB:7nmiB	0.065	0.184	1.088E-4	488	0.023	0.066	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone
14	PDB:2kayA	0.064	0.888	1.413E-4	92	0.020	0.304	2kayA.pdb.gz	Solution structure and dynamics of S100A5 in the apo and Ca2+-bound states
15	PDB:7ui5A	0.059	0.620	2.899E-4	114	0.024	0.298	7ui5A.pdb.gz	Evolution avoids a pathological stabilizing interaction in the immune protein S100A9.
16	AFDB:Q5JSZ5	0.044	0.031	2.175E-2	2229	0.166	0.104	Q5JSZ5.pdb.gz	PRC2B_HUMAN Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2
17	AFDB:Q9Z1Q1	0.041	0.033	2.647E-2	1818	0.132	0.102	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
18	AFDB:Q8IZD2	0.035	0.029	3.220E-2	1858	0.142	0.107	Q8IZD2.pdb.gz	KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1
19	AFDB:Q9VUE8	0.033	0.022	3.917E-2	2637	0.148	0.078	Q9VUE8.pdb.gz	Q9VUE8_DROME Big bang, isoform C OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=2
20	AFDB:Q9BVV6	0.037	0.037	7.531E-2	1533	0.133	0.121	Q9BVV6.pdb.gz	TALD3_HUMAN Protein TALPID3 OS=Homo sapiens OX=9606 GN=KIAA0586 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20930	0.0	1306	4061	0.641	0.221	FILA_HUMAN Filaggrin OS=Homo sapiens OX=9606 GN=FLG PE=1 SV=3
2	Q05331	0.0	1754	1218	0.749	0.860	Q05331_HUMAN Profilaggrin (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
3	Q8VHD8	7.28e-45	181	2496	0.052	0.029	HORN_MOUSE Hornerin OS=Mus musculus OX=10090 GN=Hrnr PE=1 SV=1
4	Q86YZ3	6.93e-38	158	2850	0.039	0.019	HORN_HUMAN Hornerin OS=Homo sapiens OX=9606 GN=HRNR PE=1 SV=2
5	Q8CIU0	1.79e-37	150	501	0.124	0.345	Q8CIU0_RAT Profilaggrin (Fragment) OS=Rattus norvegicus OX=10116 GN=Flg PE=4 SV=1
6	Q2VIS4	5.36e-37	155	2362	0.043	0.025	FILA2_MOUSE Filaggrin-2 OS=Mus musculus OX=10090 GN=Flg2 PE=1 SV=2
7	Q5D862	4.67e-30	132	2391	0.066	0.039	FILA2_HUMAN Filaggrin-2 OS=Homo sapiens OX=9606 GN=FLG2 PE=1 SV=1
8	Q6XPR3	2.21e-23	109	784	0.027	0.048	RPTN_HUMAN Repetin OS=Homo sapiens OX=9606 GN=RPTN PE=1 SV=1
9	Q9UBG3	2.80e-23	107	495	0.027	0.077	CRNN_HUMAN Cornulin OS=Homo sapiens OX=9606 GN=CRNN PE=1 SV=1
10	P97347	6.05e-22	105	1118	0.027	0.034	RPTN_MOUSE Repetin OS=Mus musculus OX=10090 GN=Rptn PE=2 SV=2
11	A0A0B4J1F9	7.30e-16	86.3	1599	0.028	0.024	A0A0B4J1F9_MOUSE Trichohyalin OS=Mus musculus OX=10090 GN=Tchh PE=1 SV=1
12	Q07283	1.09e-11	72.4	1943	0.030	0.022	TRHY_HUMAN Trichohyalin OS=Homo sapiens OX=9606 GN=TCHH PE=1 SV=2
13	P80511	2.29e-11	63.5	92	0.026	0.391	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
14	P80310	3.44e-11	63.2	92	0.023	0.348	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
15	P79105	9.49e-11	62.0	92	0.023	0.348	S10AC_BOVIN Protein S100-A12 OS=Bos taurus OX=9913 GN=S100A12 PE=1 SV=3
16	P25815	1.61e-10	61.2	95	0.024	0.347	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
17	P50543	2.06e-09	58.2	98	0.021	0.306	S10AB_MOUSE Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1
18	P35467	1.39e-08	55.8	94	0.021	0.319	S10A1_RAT Protein S100-A1 OS=Rattus norvegicus OX=10116 GN=S100a1 PE=1 SV=3
19	P31949	1.54e-08	55.8	105	0.021	0.286	S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2
20	P02638	1.73e-08	55.5	92	0.022	0.337	S100B_BOVIN Protein S100-B OS=Bos taurus OX=9913 GN=S100B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	1.4e+02	13.4	EF hand
2	PF13405 EF-hand_6	3e+02	12.7	EF-hand domain
3	PF13499 EF-hand_7	1.5	20.7	EF-hand domain pair
4	PF03516 Filaggrin	1.3e-93	318.9	Filaggrin
5	PF01023 S_100	3.2e-13	60.4	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357789

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337733	0.989	Kallikrein-5
2	9606.ENSP00000393417	0.974	Caspase-14
3	9606.ENSP00000278742	0.962	Suppressor of tumorigenicity 14 protein
4	9606.ENSP00000319730	0.939	Prostasin
5	9606.ENSP00000357731	0.933	Loricrin
6	9606.ENSP00000431984	0.924	Calpain-1 catalytic subunit
7	9606.ENSP00000482760	0.921	Proprotein convertase subtilisin/kexin type 6
8	9606.ENSP00000483552	0.915	Furin
9	9606.ENSP00000357753	0.913	Involucrin
10	9606.ENSP00000246533	0.900	Calpain small subunit 1
11	9606.ENSP00000352639	0.900	Chymotrypsin-like elastase family member 2A
12	9606.ENSP00000257192	0.872	Desmoglein-1
13	9606.ENSP00000252244	0.864	Keratin, type II cytoskeletal 1
14	9606.ENSP00000269576	0.831	Keratin, type I cytoskeletal 10
15	9606.ENSP00000257198	0.809	Desmocollin-1
16	9606.ENSP00000257189	0.777	Desmoglein-3
17	9606.ENSP00000369129	0.774	Desmoplakin
18	9606.ENSP00000206765	0.739	Protein-glutamine gamma-glutamyltransferase K
19	9606.ENSP00000352936	0.737	Serine protease inhibitor Kazal-type 5
20	9606.ENSP00000353608	0.722	Desmocollin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	0.998	protein binding
GO:0005509	0.977	calcium ion binding
GO:0042802	0.460	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0030216	0.985	keratinocyte differentiation
GO:0018149	0.969	peptide cross-linking
GO:0098773	0.940	skin epidermis development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0001533	1.000	cornified envelope
GO:0005737	0.997	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005634	0.991	nucleus
GO:0005829	0.983	cytosol
GO:0099080	0.967	supramolecular complex
GO:0031012	0.960	extracellular matrix
GO:0035770	0.909	ribonucleoprotein granule
GO:0062023	0.905	collagen-containing extracellular matrix
GO:0036464	0.903	cytoplasmic ribonucleoprotein granule
GO:0043233	0.300	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]