StarFunc result for job id P20936

User Input

>input (1047 residues)
MMAAEAGSEEGGPVTAGAGGGGAAAGSSAYPAVCRVKIPAALPVAAAPYPGLVETGVAGT
LGGGAALGSEFLGAGSVAGALGGAGLTGGGTAAGVAGAAAGVAGAAVAGPSGDMALTKLP
TSLLAETLGPGGGFPPLPPPPYLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQ
WYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYY
IGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEIS
FLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQE
AYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIG
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGY
LLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNC
FQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHI
EEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSN
KTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPE
EEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISM
EDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNED
VNTNLTHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFV
FLRLICPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFI
KSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQ
HVLKKLLAITELLQQKQNQYTKTNDVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20936	1.000	1.000	0.000	1047	1.000	1.000	P20936.pdb.gz	RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RASA1 PE=1 SV=1
2	AFDB:E7F916	0.264	0.329	9.127E-23	833	0.110	0.138	E7F916.pdb.gz	E7F916_DANRE RAS p21 protein activator 3 OS=Danio rerio OX=7955 GN=rasa3 PE=1 SV=1
3	AFDB:Q14644	0.352	0.438	2.011E-22	834	0.107	0.134	Q14644.pdb.gz	RASA3_HUMAN Ras GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=RASA3 PE=1 SV=3
4	AFDB:Q15283	0.324	0.392	8.900E-22	850	0.100	0.124	Q15283.pdb.gz	RASA2_HUMAN Ras GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=RASA2 PE=1 SV=3
5	AFDB:P48423	0.311	0.281	6.113E-20	1163	0.109	0.098	P48423.pdb.gz	GAP1_DROME GTPase-activating protein OS=Drosophila melanogaster OX=7227 GN=RasGAP1 PE=1 SV=2
6	AFDB:Q63713	0.341	0.417	6.113E-20	847	0.106	0.131	Q63713.pdb.gz	RASA2_RAT Ras GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Rasa2 PE=2 SV=1
7	AFDB:Q54Q13	0.278	0.276	1.059E-15	1056	0.088	0.087	Q54Q13.pdb.gz	Q54Q13_DICDI Ras GTPase activation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284177 PE=4 SV=1
8	PDB:7r04A	0.265	0.122	1.182E-13	2326	0.086	0.039	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
9	PDB:7mp5A	0.255	0.166	5.742E-13	1629	0.082	0.053	7mp5A.pdb.gz
10	PDB:7r03B	0.258	0.123	1.672E-12	2246	0.080	0.037	7r03B.pdb.gz
11	PDB:7pgrN	0.269	0.121	7.064E-12	2423	0.079	0.034	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
12	PDB:4fl2A	0.117	0.178	3.430E-11	555	0.069	0.130	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.108	0.194	8.296E-11	551	0.071	0.134	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:7r04B	0.223	0.106	1.590E-10	2229	0.074	0.035	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
15	PDB:4gwfA	0.143	0.269	2.651E-10	497	0.066	0.139	4gwfA.pdb.gz
16	PDB:3ps5A	0.089	0.168	6.717E-10	529	0.061	0.121	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
17	PDB:5xzrA	0.147	0.269	8.474E-10	519	0.066	0.133	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
18	AFDB:P42684	0.124	0.112	2.250E-8	1182	0.067	0.059	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
19	AFDB:Q5SSZ5	0.090	0.066	2.828E-6	1440	0.092	0.067	Q5SSZ5.pdb.gz	TENS3_MOUSE Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1
20	AFDB:E9Q0S6	0.100	0.060	6.232E-6	1888	0.085	0.047	E9Q0S6.pdb.gz	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YDU0	0.0	999	497	0.458	0.966	A0A286YDU0_MOUSE RAS p21 protein activator 1 (Fragment) OS=Mus musculus OX=10090 GN=Rasa1 PE=1 SV=1
2	E9PYG6	0.0	1867	1038	0.941	0.949	E9PYG6_MOUSE RAS p21 protein activator 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=1 SV=1
3	F1R3X3	0.0	1609	1010	0.759	0.787	F1R3X3_DANRE RAS p21 protein activator (GTPase-activating protein) 1a OS=Danio rerio OX=7955 GN=rasa1a PE=1 SV=2
4	P20936	0.0	2175	1047	1.000	1.000	RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RASA1 PE=1 SV=1
5	P50904	0.0	1848	1038	0.942	0.950	RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Rasa1 PE=1 SV=1
6	Q3TTA2	0.0	998	488	0.458	0.984	Q3TTA2_MOUSE Ras GTPase-activating protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1
7	Q3V090	0.0	1535	742	0.700	0.988	Q3V090_MOUSE Ras GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1
8	Q8IR23	0.0	807	954	0.414	0.454	Q8IR23_DROME GH13542p OS=Drosophila melanogaster OX=7227 GN=vap PE=2 SV=2
9	Q91YX7	0.0	1686	813	0.768	0.989	Q91YX7_MOUSE RAS p21 protein activator 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1
10	Q8MLZ5	8.95e-55	210	1207	0.135	0.117	GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans OX=6239 GN=gap-2 PE=2 SV=2
11	Q3UHC7	9.36e-46	182	1189	0.134	0.118	DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1
12	Q5VWQ8	1.71e-45	181	1189	0.135	0.119	DAB2P_HUMAN Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP PE=1 SV=2
13	Q54Y08	5.89e-45	178	877	0.106	0.127	NGAP_DICDI Probable Ras GTPase-activating-like protein ngap OS=Dictyostelium discoideum OX=44689 GN=ngap PE=2 SV=1
14	E9PW37	5.93e-43	173	1286	0.137	0.111	E9PW37_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
15	Q0VAV5	6.08e-43	173	1268	0.137	0.113	Q0VAV5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=2 SV=1
16	D3YUS5	7.23e-43	172	1261	0.137	0.113	D3YUS5_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
17	Q9UJF2	1.71e-42	171	1139	0.136	0.125	NGAP_HUMAN Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2
18	Q6P730	1.82e-41	167	996	0.122	0.129	DAB2P_RAT Disabled homolog 2-interacting protein OS=Rattus norvegicus OX=10116 GN=Dab2ip PE=1 SV=1
19	Q86YV0	2.71e-39	160	1011	0.126	0.131	RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens OX=9606 GN=RASAL3 PE=1 SV=2
20	E7F1U4	1.73e-37	155	1507	0.128	0.089	E7F1U4_DANRE Ras/Rap GTPase-activating protein SynGAP1b OS=Danio rerio OX=7955 GN=si:dkey-246f6.1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.7e-08	46.1	C2 domain
2	PF14932 HAUS-augmin3	7.7e+02	10.9	HAUS augmin-like complex subunit 3
3	PF00169 PH	8.6e-14	63.3	PH domain
4	PF15413 PH_11	11	17.9	Pleckstrin homology domain
5	PF00616 RasGAP	1.1e-22	92.4	GTPase-activator protein for Ras-like GTPase
6	PF00017 SH2	5e-40	146.8	SH2 domain
7	PF14633 SH2_2	1.2	20.1	SH2 domain
8	PF00018 SH3_1	7.2e-07	40.0	SH3 domain
9	PF07653 SH3_2	24	16.2	Variant SH3 domain
10	PF14604 SH3_9	0.098	23.9	Variant SH3 domain
11	PF06220 zf-U1	1.5e+02	13.5	U1 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274376

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233668	0.999	Docking protein 1
2	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
3	9606.ENSP00000385720	0.999	Rho GTPase-activating protein 35
4	9606.ENSP00000407586	0.999	GTPase HRas
5	9606.ENSP00000330341	0.998	Suppressor of cytokine signaling 3
6	9606.ENSP00000276420	0.997	Docking protein 2
7	9606.ENSP00000313829	0.997	KH domain-containing, RNA-binding, signal transduction-associated protein 1
8	9606.ENSP00000261799	0.992	Platelet-derived growth factor receptor beta
9	9606.ENSP00000256078	0.980	GTPase KRas
10	9606.ENSP00000346550	0.980	Annexin A6
11	9606.ENSP00000417273	0.980	Cytoplasmic protein NCK1
12	9606.ENSP00000426909	0.973	Receptor of activated protein C kinase 1
13	9606.ENSP00000307046	0.970	Syndecan-2
14	9606.ENSP00000363763	0.969	Ephrin type-B receptor 2
15	9606.ENSP00000362680	0.966	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000358548	0.964	GTPase NRas
17	9606.ENSP00000400175	0.964	Transforming protein RhoA
18	9606.ENSP00000401303	0.964	SHC-transforming protein 1
19	9606.ENSP00000267257	0.963	Paxillin
20	9606.ENSP00000337825	0.954	Tyrosine-protein kinase Lck

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.987	enzyme binding
GO:0030234	0.986	enzyme regulator activity
GO:0140677	0.985	molecular function activator activity
GO:0003824	0.981	catalytic activity
GO:0030695	0.979	GTPase regulator activity
GO:0008047	0.979	enzyme activator activity
GO:0005096	0.971	GTPase activator activity
GO:0005102	0.963	signaling receptor binding
GO:0001784	0.950	phosphotyrosine residue binding
GO:0003924	0.784	GTPase activity
GO:0051020	0.730	GTPase binding
GO:0019900	0.403	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0009987	0.993	cellular process
GO:0051716	0.976	cellular response to stimulus
GO:0007165	0.972	signal transduction
GO:0032501	0.963	multicellular organismal process
GO:0048856	0.958	anatomical structure development
GO:0007275	0.943	multicellular organism development
GO:0007169	0.938	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048519	0.928	negative regulation of biological process
GO:0048731	0.902	system development
GO:0048518	0.901	positive regulation of biological process
GO:0048522	0.891	positive regulation of cellular process
GO:0048523	0.841	negative regulation of cellular process
GO:0030155	0.832	regulation of cell adhesion
GO:0019222	0.824	regulation of metabolic process
GO:0048013	0.793	ephrin receptor signaling pathway
GO:0051128	0.753	regulation of cellular component organization
GO:0060255	0.715	regulation of macromolecule metabolic process
GO:0080090	0.714	regulation of primary metabolic process
GO:0050790	0.695	regulation of catalytic activity
GO:0010941	0.695	regulation of cell death
GO:0048583	0.662	regulation of response to stimulus
GO:0065008	0.643	regulation of biological quality
GO:0033043	0.643	regulation of organelle organization
GO:0051171	0.613	regulation of nitrogen compound metabolic process
GO:0001568	0.612	blood vessel development
GO:0031323	0.610	regulation of cellular metabolic process
GO:0071840	0.524	cellular component organization or biogenesis
GO:0009893	0.490	positive regulation of metabolic process
GO:0016043	0.488	cellular component organization
GO:0042325	0.482	regulation of phosphorylation
GO:0023051	0.473	regulation of signaling
GO:0010646	0.472	regulation of cell communication
GO:0031399	0.471	regulation of protein modification process
GO:0044093	0.470	positive regulation of molecular function
GO:0031325	0.456	positive regulation of cellular metabolic process
GO:0044087	0.454	regulation of cellular component biogenesis
GO:0051173	0.454	positive regulation of nitrogen compound metabolic process
GO:0009966	0.451	regulation of signal transduction
GO:0051247	0.442	positive regulation of protein metabolic process
GO:0001932	0.442	regulation of protein phosphorylation
GO:0042981	0.433	regulation of apoptotic process
GO:0032879	0.420	regulation of localization
GO:0032970	0.417	regulation of actin filament-based process
GO:0043085	0.364	positive regulation of catalytic activity
GO:0051336	0.357	regulation of hydrolase activity
GO:0045937	0.355	positive regulation of phosphate metabolic process
GO:0042221	0.348	response to chemical
GO:0008152	0.343	metabolic process
GO:0009719	0.338	response to endogenous stimulus
GO:0042127	0.318	regulation of cell population proliferation
GO:0071495	0.316	cellular response to endogenous stimulus
GO:0051049	0.316	regulation of transport
GO:0031401	0.315	positive regulation of protein modification process
GO:0051493	0.313	regulation of cytoskeleton organization
GO:0070848	0.311	response to growth factor
GO:0001934	0.300	positive regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0043226	0.816	organelle
GO:0043231	0.788	intracellular membrane-bounded organelle
GO:0120025	0.586	plasma membrane bounded cell projection
GO:0012505	0.363	endomembrane system
GO:0031252	0.300	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.784	GTP + H2O = GDP + H(+) + phosphate

[back to server]