StarFunc result for job id P20963

User Input

>input (164 residues)
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSAD
APAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMA
EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20963	1.000	1.000	5.904E-27	164	1.000	1.000	P20963.pdb.gz	CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain OS=Homo sapiens OX=9606 GN=CD247 PE=1 SV=2
2	AFDB:P24161	0.343	0.343	1.313E-14	164	0.811	0.811	P24161.pdb.gz	CD3Z_MOUSE T-cell surface glycoprotein CD3 zeta chain OS=Mus musculus OX=10090 GN=Cd247 PE=1 SV=1
3	AFDB:M0R576	0.322	0.378	4.255E-12	137	0.707	0.847	M0R576.pdb.gz	M0R576_RAT T-cell surface glycoprotein CD3 zeta chain OS=Rattus norvegicus OX=10116 GN=Cd247 PE=1 SV=2
4	AFDB:Q45UC9	0.219	0.261	2.727E-2	132	0.220	0.273	Q45UC9.pdb.gz	Q45UC9_ICTPU CD247 antigen like precursor OS=Ictalurus punctatus OX=7998 GN=cd247l PE=2 SV=1
5	AFDB:Q13033	0.143	0.047	1.073	797	0.189	0.039	Q13033.pdb.gz	STRN3_HUMAN Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3
6	AFDB:Q9D2S4	0.114	0.105	1.316	182	0.177	0.159	Q9D2S4.pdb.gz	SPAC7_MOUSE Sperm acrosome-associated protein 7 OS=Mus musculus OX=10090 GN=Spaca7 PE=1 SV=1
7	AFDB:A0A1L1QZH7	0.175	0.135	1.980	214	0.201	0.154	A0A1L1QZH7.pdb.gz
8	AFDB:H2L0F6	0.223	0.082	2.599	568	0.128	0.037	H2L0F6.pdb.gz	H2L0F6_CAEEL BZIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-4 PE=1 SV=1
9	AFDB:Q9VNP6	0.146	0.108	2.977	229	0.110	0.079	Q9VNP6.pdb.gz	Q9VNP6_DROME RE03780p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11131 PE=1 SV=1
10	AFDB:G3XAA4	0.175	0.038	3.411	834	0.128	0.025	G3XAA4.pdb.gz	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
11	PDB:6lss4	0.191	0.057	4.915	620	0.128	0.034	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20963	7.21e-120	337	164	1.000	1.000	CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain OS=Homo sapiens OX=9606 GN=CD247 PE=1 SV=2
2	Q4V7G0	6.24e-101	288	164	0.854	0.854	Q4V7G0_RAT T-cell surface glycoprotein CD3 zeta chain OS=Rattus norvegicus OX=10116 GN=Cd247 PE=1 SV=1
3	P24161	1.22e-95	275	164	0.811	0.811	CD3Z_MOUSE T-cell surface glycoprotein CD3 zeta chain OS=Mus musculus OX=10090 GN=Cd247 PE=1 SV=1
4	M0R576	2.55e-84	248	201	0.732	0.597	M0R576_RAT T-cell surface glycoprotein CD3 zeta chain OS=Rattus norvegicus OX=10116 GN=Cd247 PE=1 SV=2
5	P20491	1.77e-11	59.3	86	0.177	0.337	FCERG_MOUSE High affinity immunoglobulin epsilon receptor subunit gamma OS=Mus musculus OX=10090 GN=Fcer1g PE=1 SV=1
6	P20411	4.27e-11	58.2	86	0.201	0.384	FCERG_RAT High affinity immunoglobulin epsilon receptor subunit gamma OS=Rattus norvegicus OX=10116 GN=Fcer1g PE=1 SV=1
7	P30273	2.86e-08	50.8	86	0.146	0.279	FCERG_HUMAN High affinity immunoglobulin epsilon receptor subunit gamma OS=Homo sapiens OX=9606 GN=FCER1G PE=1 SV=1
8	Q45UC9	8.15e-06	45.1	132	0.091	0.114	Q45UC9_ICTPU CD247 antigen like precursor OS=Ictalurus punctatus OX=7998 GN=cd247l PE=2 SV=1
9	Q8AY96	2.13e-05	43.1	87	0.116	0.218	Q8AY96_ICTPU High affinity immunoglobulin epsilon receptor subunit gamma OS=Ictalurus punctatus OX=7998 GN=fcer1gl PE=2 SV=1
10	Q7SYB5	2.1	30.8	612	0.189	0.051	DEFI6_DANRE Differentially expressed in FDCP 6 homolog OS=Danio rerio OX=7955 GN=def6 PE=2 SV=1
11	Q6XPS3	3.3	30.4	522	0.091	0.029	TPTE2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Homo sapiens OX=9606 GN=TPTE2 PE=1 SV=2
12	Q9C5C2	3.8	30.0	547	0.159	0.048	BGL37_ARATH Myrosinase 2 OS=Arabidopsis thaliana OX=3702 GN=TGG2 PE=1 SV=1
13	P42081	4.4	29.6	329	0.134	0.067	CD86_HUMAN T-lymphocyte activation antigen CD86 OS=Homo sapiens OX=9606 GN=CD86 PE=1 SV=2
14	P56180	4.4	30.0	551	0.098	0.029	TPTE_HUMAN Putative tyrosine-protein phosphatase TPTE OS=Homo sapiens OX=9606 GN=TPTE PE=1 SV=3
15	P81761	6.4	27.7	62	0.104	0.274	CTXL_HOTTA Lepidopteran-selective toxin OS=Hottentotta tamulus OX=34647 PE=1 SV=2
16	P69801	7.7	28.9	266	0.085	0.053	PTNC_ECOLI PTS system mannose-specific EIIC component OS=Escherichia coli (strain K12) OX=83333 GN=manY PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02189 ITAM	1.2e-17	74.2	Immunoreceptor tyrosine-based activation motif
2	PF11628 TCR_zetazeta	2.1e-14	64.4	T-cell surface glycoprotein CD3 zeta chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354782

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264972	0.999	Tyrosine-protein kinase ZAP-70
2	9606.ENSP00000300692	0.999	T-cell surface glycoprotein CD3 delta chain
3	9606.ENSP00000337825	0.999	Tyrosine-protein kinase Lck
4	9606.ENSP00000354566	0.999	T-cell surface glycoprotein CD3 epsilon chain
5	9606.ENSP00000342156	0.998	Natural cytotoxicity triggering receptor 3
6	9606.ENSP00000431445	0.997	T-cell surface glycoprotein CD3 gamma chain
7	9606.ENSP00000433642	0.997	Low affinity immunoglobulin gamma Fc region receptor III-B
8	9606.ENSP00000291890	0.996	Natural cytotoxicity triggering receptor 1
9	9606.ENSP00000324890	0.995	T-cell-specific surface glycoprotein CD28
10	9606.ENSP00000386559	0.995	T-cell surface glycoprotein CD8 alpha chain
11	9606.ENSP00000358490	0.994	T-cell surface antigen CD2
12	9606.ENSP00000401303	0.994	SHC-transforming protein 1
13	9606.ENSP00000346671	0.993	Tyrosine-protein kinase Fyn
14	9606.ENSP00000356946	0.993	Low affinity immunoglobulin gamma Fc region receptor III-A
15	9606.ENSP00000011653	0.989	T-cell surface glycoprotein CD4
16	9606.ENSP00000295756	0.986	T-cell receptor-associated transmembrane adapter 1
17	9606.ENSP00000398655	0.986	Tyrosine-protein kinase ITK/TSK
18	9606.ENSP00000411355	0.986	Receptor-type tyrosine-protein phosphatase C
19	9606.ENSP00000472929	0.979	Proto-oncogene vav
20	9606.ENSP00000046794	0.976	Lymphocyte cytosolic protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.995	identical protein binding
GO:0038023	0.977	signaling receptor activity
GO:0019899	0.975	enzyme binding
GO:0004888	0.971	transmembrane signaling receptor activity
GO:0046982	0.970	protein heterodimerization activity
GO:0042803	0.969	protein homodimerization activity
GO:0019901	0.935	protein kinase binding
GO:1990782	0.924	protein tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0007166	0.992	cell surface receptor signaling pathway
GO:0048583	0.908	regulation of response to stimulus
GO:0002682	0.897	regulation of immune system process
GO:0050776	0.880	regulation of immune response
GO:0048518	0.672	positive regulation of biological process
GO:0002764	0.645	immune response-regulating signaling pathway
GO:0002768	0.493	immune response-regulating cell surface receptor signaling pathway
GO:0048522	0.446	positive regulation of cellular process
GO:0002376	0.438	immune system process
GO:0002684	0.340	positive regulation of immune system process
GO:0048584	0.311	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042101	1.000	T cell receptor complex
GO:0005737	0.988	cytoplasm
GO:0043227	0.938	membrane-bounded organelle
GO:0043229	0.927	intracellular organelle
GO:0043231	0.876	intracellular membrane-bounded organelle
GO:0012505	0.423	endomembrane system
GO:0033001	0.386	Fc-gamma receptor III complex
GO:0042105	0.329	alpha-beta T cell receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]