StarFunc result for job id P21108

User Input

>input (318 residues)
MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGC
GEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRSPISAKLVANMLSIAG
ADHIITMDLHASQIQGFFDIPVDNLYAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTS
IADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAG
ATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQDEKMKHCSKIRVIDISMILAEAI
RRTHNGESVSYLFSHVPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0RBK1	1.000	1.000	9.399E-65	318	0.918	0.918	M0RBK1.pdb.gz	M0RBK1_RAT ribose-phosphate diphosphokinase OS=Rattus norvegicus OX=10116 GN=Prps1l1 PE=3 SV=1
2	AFDB:Q9VT33	0.988	0.810	1.035E-60	388	0.849	0.696	Q9VT33.pdb.gz	Q9VT33_DROME ribose-phosphate diphosphokinase OS=Drosophila melanogaster OX=7227 GN=Prps PE=1 SV=3
3	PDB:4lygB	0.966	0.991	1.040E-57	310	0.915	0.939	4lygB.pdb.gz
4	AFDB:O94413	0.981	0.972	1.087E-53	321	0.682	0.676	O94413.pdb.gz	KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1620.06c PE=1 SV=1
5	AFDB:Q5BBW5	0.984	0.978	6.279E-52	320	0.648	0.644	Q5BBW5.pdb.gz	Q5BBW5_EMENI ribose-phosphate diphosphokinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01965 PE=3 SV=1
6	AFDB:Q54PA9	0.969	0.972	2.389E-50	317	0.597	0.599	Q54PA9.pdb.gz	PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum OX=44689 GN=prsA PE=1 SV=1
7	AFDB:P38620	0.972	0.972	6.588E-50	318	0.601	0.601	P38620.pdb.gz	KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS2 PE=1 SV=1
8	AFDB:P38063	0.969	0.945	1.816E-49	326	0.616	0.601	P38063.pdb.gz	KPR4_YEAST Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS4 PE=1 SV=3
9	AFDB:Q5ALK3	0.978	0.972	1.651E-48	320	0.575	0.572	Q5ALK3.pdb.gz	Q5ALK3_CANAL ribose-phosphate diphosphokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PRS1 PE=3 SV=1
10	AFDB:P38689	0.973	0.967	3.378E-48	320	0.585	0.581	P38689.pdb.gz	KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS3 PE=1 SV=1
11	AFDB:Q5B8G1	0.950	0.696	1.063E-44	435	0.557	0.407	Q5B8G1.pdb.gz	Q5B8G1_EMENI Ribose-phosphate pyrophosphokinase (AFU_orthologue AFUA_3G13380) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03169 PE=3 SV=1
12	PDB:4s2uA	0.932	0.962	9.044E-39	308	0.456	0.471	4s2uA.pdb.gz	Crystal structure of the Phosphorybosylpyrophosphate synthetase from E. Coli
13	PDB:2c4kA	0.922	0.960	9.834E-38	305	0.456	0.475	2c4kA.pdb.gz
14	PDB:2ji4A	0.899	0.945	1.441E-36	302	0.456	0.480	2ji4A.pdb.gz
15	PDB:1a95B	0.239	0.417	1.240E-5	150	0.069	0.147	1a95B.pdb.gz	Structures of free and complexed forms of Escherichia coli xanthine-guanine phosphoribosyltransferase.
16	PDB:5vn4A	0.294	0.379	2.252E-5	237	0.116	0.156	5vn4A.pdb.gz	Crystal structure of adenine phosphoribosyl transferase from Trypanosoma brucei in complex with AMP, pyrophosphate, and ribose-5-phosphate
17	PDB:5vjpB	0.323	0.547	1.348E-4	179	0.075	0.134	5vjpB.pdb.gz	Synthesis of bis-Phosphate Iminoaltritol Enantiomers and Structural Characterization with Adenine Phosphoribosyltransferase.
18	PDB:5knyB	0.273	0.431	1.817E-4	187	0.063	0.107	5knyB.pdb.gz	Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with pyrrolidine nucleoside phosphonate
19	PDB:6fciA	0.302	0.505	3.109E-4	179	0.072	0.128	6fciA.pdb.gz	Structural Insights into the Forward and Reverse Enzymatic Reactions in Human Adenine Phosphoribosyltransferase.
20	PDB:2ehjA	0.246	0.350	3.718E-4	208	0.057	0.087	2ehjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0RBK1	0.0	604	318	0.918	0.918	M0RBK1_RAT ribose-phosphate diphosphokinase OS=Rattus norvegicus OX=10116 GN=Prps1l1 PE=3 SV=1
2	P09330	0.0	602	318	0.912	0.912	PRPS2_RAT Ribose-phosphate pyrophosphokinase 2 OS=Rattus norvegicus OX=10116 GN=Prps2 PE=1 SV=3
3	P11908	0.0	602	318	0.912	0.912	PRPS2_HUMAN Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens OX=9606 GN=PRPS2 PE=1 SV=2
4	P60891	0.0	617	318	0.943	0.943	PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2
5	P60892	0.0	617	318	0.943	0.943	PRPS1_RAT Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus OX=10116 GN=Prps1 PE=1 SV=2
6	Q9CS42	0.0	602	318	0.912	0.912	PRPS2_MOUSE Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus OX=10090 GN=Prps2 PE=1 SV=4
7	Q9D7G0	0.0	617	318	0.943	0.943	PRPS1_MOUSE Ribose-phosphate pyrophosphokinase 1 OS=Mus musculus OX=10090 GN=Prps1 PE=1 SV=4
8	Q9VT33	0.0	553	388	0.855	0.701	Q9VT33_DROME ribose-phosphate diphosphokinase OS=Drosophila melanogaster OX=7227 GN=Prps PE=1 SV=3
9	O94413	1.36e-157	445	321	0.682	0.676	KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1620.06c PE=1 SV=1
10	Q5BBW5	7.63e-151	427	320	0.651	0.647	Q5BBW5_EMENI ribose-phosphate diphosphokinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01965 PE=3 SV=1
11	P38063	4.96e-138	395	326	0.616	0.601	KPR4_YEAST Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS4 PE=1 SV=3
12	Q54PA9	1.89e-137	394	317	0.601	0.603	PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum OX=44689 GN=prsA PE=1 SV=1
13	P38689	4.82e-134	385	320	0.591	0.588	KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS3 PE=1 SV=1
14	P38620	3.79e-133	382	318	0.601	0.601	KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS2 PE=1 SV=1
15	Q5ALK3	1.17e-132	381	320	0.575	0.572	Q5ALK3_CANAL ribose-phosphate diphosphokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PRS1 PE=3 SV=1
16	P0A717	1.15e-98	295	315	0.472	0.476	KPRS_ECOLI Ribose-phosphate pyrophosphokinase OS=Escherichia coli (strain K12) OX=83333 GN=prs PE=1 SV=2
17	O60256	3.47e-90	275	369	0.481	0.415	KPRB_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2 PE=1 SV=1
18	O64888	7.21e-89	273	394	0.425	0.343	KPRS5_ARATH Ribose-phosphate pyrophosphokinase 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRS5 PE=2 SV=2
19	O08618	1.10e-88	271	369	0.478	0.412	KPRB_RAT Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Prpsap2 PE=1 SV=1
20	Q8R574	1.18e-88	271	369	0.478	0.412	KPRB_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus OX=10090 GN=Prpsap2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19867 DUF6340	5.3e+02	11.2	Family of unknown function (DUF6340)
2	PF00156 Pribosyltran	9.2e-08	43.1	Phosphoribosyl transferase domain
3	PF13793 Pribosyltran_N	1.4e-45	165.4	N-terminal domain of ribose phosphate pyrophosphokinase
4	PF14572 Pribosyl_synth	1.2e-39	147.6	Phosphoribosyl synthetase-associated domain
5	PF14681 UPRTase	6	17.8	Uracil phosphoribosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424595

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306817	0.966	Ribokinase
2	9606.ENSP00000283646	0.964	Ribose 5-phosphate isomerase A
3	9606.ENSP00000264220	0.960	Amidophosphoribosyltransferase
4	9606.ENSP00000232607	0.948	Uridine 5'-monophosphate synthase
5	9606.ENSP00000361512	0.947	Ribose-phosphate pyrophosphokinase 1
6	9606.ENSP00000391481	0.943	Transketolase
7	9606.ENSP00000280605	0.938	Transketolase-like protein 2
8	9606.ENSP00000358931	0.930	Transketolase-like protein 1
9	9606.ENSP00000371393	0.930	Phosphoglucomutase-2
10	9606.ENSP00000268835	0.927	Phosphoribosyl pyrophosphate synthase-associated protein 2
11	9606.ENSP00000303575	0.916	ADP-ribose pyrophosphatase, mitochondrial
12	9606.ENSP00000369099	0.903	Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
13	9606.ENSP00000419628	0.903	ADP-sugar pyrophosphatase
14	9606.ENSP00000463092	0.812	Beta-microseminoprotein
15	9606.ENSP00000381504	0.804	Ribose-phosphate pyrophosphokinase 2
16	9606.ENSP00000414624	0.780	Phosphoribosyl pyrophosphate synthase-associated protein 1
17	9606.ENSP00000262843	0.735	Probable E3 ubiquitin-protein ligase MID2
18	9606.ENSP00000376946	0.690	Bardet-Biedl syndrome 10 protein
19	9606.ENSP00000371253	0.677	Trifunctional purine biosynthetic protein adenosine-3
20	9606.ENSP00000378340	0.651	Collagen alpha-6(IV) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004749	0.999	ribose phosphate diphosphokinase activity
GO:0005515	0.997	protein binding
GO:0042802	0.912	identical protein binding
GO:1901363	0.712	heterocyclic compound binding
GO:0097159	0.712	organic cyclic compound binding
GO:0043167	0.546	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901360	0.995	organic cyclic compound metabolic process
GO:0006139	0.988	nucleobase-containing compound metabolic process
GO:0006753	0.978	nucleoside phosphate metabolic process
GO:0072521	0.975	purine-containing compound metabolic process
GO:0009117	0.970	nucleotide metabolic process
GO:0046390	0.962	ribose phosphate biosynthetic process
GO:0006163	0.934	purine nucleotide metabolic process
GO:0044249	0.548	cellular biosynthetic process
GO:0044271	0.510	cellular nitrogen compound biosynthetic process
GO:0034654	0.416	nucleobase-containing compound biosynthetic process
GO:1901293	0.336	nucleoside phosphate biosynthetic process
GO:0032502	0.335	developmental process
GO:1901566	0.332	organonitrogen compound biosynthetic process
GO:0009165	0.315	nucleotide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0032991	0.950	protein-containing complex
GO:1902494	0.531	catalytic complex
GO:0043226	0.486	organelle
GO:0043229	0.421	intracellular organelle
GO:1990234	0.378	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15609	0.999	ATP + D-ribose 5-phosphate = 5-phospho-alpha-D-ribose 1-diphosphate + AMP + H(+)
EC:2.7.6.1	0.999	ribose-phosphate diphosphokinase.

[back to server]