StarFunc result for job id P21127

User Input

>input (795 residues)
MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEI
TIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGK
HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERK
MREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPRPPR
ERFELGDGRKPGEARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESG
SGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSED
EERENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALSPIELKQ
ELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPI
TSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVK
TLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVT
LWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDLGTPSEK
IWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKH
EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTT
NQGASAAGPGFSLKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21127	1.000	1.000	0.000	795	1.000	1.000	P21127.pdb.gz	CD11B_HUMAN Cyclin-dependent kinase 11B OS=Homo sapiens OX=9606 GN=CDK11B PE=1 SV=4
2	AFDB:A0A0R4IPD5	0.578	0.575	1.254E-89	800	0.755	0.750	A0A0R4IPD5.pdb.gz
3	AFDB:Q9FGW5	0.404	0.522	3.614E-46	612	0.286	0.371	Q9FGW5.pdb.gz	CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana OX=3702 GN=CDKG1 PE=1 SV=1
4	AFDB:C8V2V9	0.395	0.667	2.694E-44	467	0.226	0.385	C8V2V9.pdb.gz	C8V2V9_EMENI Protein kinase NPKA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06044 PE=4 SV=1
5	AFDB:F1QKU6	0.385	0.847	7.067E-44	360	0.218	0.481	F1QKU6.pdb.gz	F1QKU6_DANRE Cyclin-dependent kinase 10 OS=Danio rerio OX=7955 GN=zgc:110252 PE=3 SV=1
6	AFDB:Q15131	0.399	0.874	1.564E-43	360	0.214	0.472	Q15131.pdb.gz	CDK10_HUMAN Cyclin-dependent kinase 10 OS=Homo sapiens OX=9606 GN=CDK10 PE=1 SV=1
7	AFDB:O60145	0.394	0.778	6.101E-43	398	0.194	0.387	O60145.pdb.gz	PPK23_SCHPO Serine/threonine-protein kinase ppk23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk23 PE=3 SV=1
8	AFDB:A1Z840	0.392	0.798	2.579E-41	387	0.215	0.442	A1Z840.pdb.gz	A1Z840_DROME Cdc2-related kinase OS=Drosophila melanogaster OX=7227 GN=Cdc2rk PE=1 SV=1
9	AFDB:Q03957	0.379	0.563	7.182E-36	528	0.186	0.280	Q03957.pdb.gz	CTK1_YEAST CTD kinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTK1 PE=1 SV=1
10	AFDB:O14098	0.387	0.514	1.296E-34	593	0.195	0.261	O14098.pdb.gz	CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsk1 PE=1 SV=1
11	PDB:1unlA	0.350	0.930	2.430E-32	292	0.152	0.414	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
12	PDB:3mi9A	0.370	0.869	4.050E-32	329	0.145	0.350	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
13	PDB:4krcA	0.351	0.916	1.983E-31	297	0.142	0.380	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
14	PDB:4yc3A	0.345	0.908	3.700E-31	295	0.155	0.417	4yc3A.pdb.gz
15	PDB:4gcjA	0.336	0.847	2.695E-30	304	0.164	0.428	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
16	PDB:4eomC	0.320	0.894	3.270E-29	276	0.157	0.453	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
17	PDB:4ek6A	0.321	0.873	1.206E-28	279	0.157	0.448	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
18	PDB:7kpvA	0.360	0.779	2.795E-26	357	0.143	0.319	7kpvA.pdb.gz
19	PDB:7opmA	0.345	0.740	3.799E-25	362	0.137	0.301	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
20	PDB:6o9l8	0.354	0.907	4.021E-25	299	0.156	0.415	6o9l8.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21127	0.0	1602	795	1.000	1.000	CD11B_HUMAN Cyclin-dependent kinase 11B OS=Homo sapiens OX=9606 GN=CDK11B PE=1 SV=4
2	P24788	0.0	1517	784	0.953	0.967	CD11B_MOUSE Cyclin-dependent kinase 11B OS=Mus musculus OX=10090 GN=Cdk11b PE=1 SV=2
3	Q5PRD1	0.0	1026	800	0.735	0.730	Q5PRD1_DANRE Cell division protein kinase 11 OS=Danio rerio OX=7955 GN=zgc:101589 PE=1 SV=1
4	Q9UQ88	0.0	1547	783	0.975	0.990	CD11A_HUMAN Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A PE=1 SV=4
5	Q9VPC0	0.0	569	952	0.346	0.289	KP58_DROME Serine/threonine-protein kinase PITSLRE OS=Drosophila melanogaster OX=7227 GN=Pitslre PE=1 SV=1
6	Q9CAG1	4.27e-156	474	752	0.283	0.299	Q9CAG1_ARATH cyclin-dependent kinase OS=Arabidopsis thaliana OX=3702 GN=CDKG2 PE=1 SV=1
7	Q09437	1.26e-147	452	719	0.267	0.295	CD111_CAEEL Cyclin-dependent kinase 11.1 OS=Caenorhabditis elegans OX=6239 GN=cdk-11.1 PE=1 SV=1
8	Q9FGW5	2.74e-132	408	612	0.240	0.312	CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana OX=3702 GN=CDKG1 PE=1 SV=1
9	F1QKU6	8.51e-130	393	360	0.219	0.483	F1QKU6_DANRE Cyclin-dependent kinase 10 OS=Danio rerio OX=7955 GN=zgc:110252 PE=3 SV=1
10	Q3UMM4	1.43e-120	369	360	0.215	0.475	CDK10_MOUSE Cyclin-dependent kinase 10 OS=Mus musculus OX=10090 GN=Cdk10 PE=1 SV=1
11	Q23357	7.85e-120	378	668	0.226	0.269	CD112_CAEEL Cyclin-dependent kinase 11.2 OS=Caenorhabditis elegans OX=6239 GN=cdk-11.2 PE=1 SV=2
12	Q15131	1.23e-119	367	360	0.214	0.472	CDK10_HUMAN Cyclin-dependent kinase 10 OS=Homo sapiens OX=9606 GN=CDK10 PE=1 SV=1
13	C8V2V9	3.69e-109	343	467	0.213	0.362	C8V2V9_EMENI Protein kinase NPKA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06044 PE=4 SV=1
14	Q24294	3.02e-107	334	349	0.200	0.456	Q24294_DROME Dcdrk kinase OS=Drosophila melanogaster OX=7227 GN=Cdc2rk PE=3 SV=1
15	A1Z840	7.86e-107	334	387	0.200	0.411	A1Z840_DROME Cdc2-related kinase OS=Drosophila melanogaster OX=7227 GN=Cdc2rk PE=1 SV=1
16	O60145	1.17e-106	334	398	0.192	0.384	PPK23_SCHPO Serine/threonine-protein kinase ppk23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk23 PE=3 SV=1
17	Q8IGS3	4.08e-94	299	333	0.181	0.432	Q8IGS3_DROME RE37740p OS=Drosophila melanogaster OX=7227 GN=Cdc2rk PE=2 SV=1
18	Q9LFT8	1.08e-87	288	505	0.192	0.303	CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana OX=3702 GN=CDKC-1 PE=1 SV=1
19	P29618	1.43e-85	275	294	0.175	0.473	CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica OX=39947 GN=CDKA-1 PE=1 SV=1
20	Q8W4P1	1.54e-85	283	513	0.187	0.290	CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana OX=3702 GN=CDKC-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14531 Kinase-like	1	20.2	Kinase-like
2	PF00069 Pkinase	9.8e-63	223.6	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1.2e-27	108.5	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362082	0.990	G1/S-specific cyclin-D3
2	9606.ENSP00000363822	0.925	Androgen receptor
3	9606.ENSP00000383611	0.870	Cyclin-L2
4	9606.ENSP00000295926	0.776	Cyclin-L1
5	9606.ENSP00000348308	0.768	Matrix metalloproteinase-23
6	9606.ENSP00000457723	0.736	RNA-binding protein with serine-rich domain 1
7	9606.ENSP00000431800	0.659	Eukaryotic translation initiation factor 3 subunit F
8	9606.ENSP00000262506	0.655	Casein kinase II subunit alpha
9	9606.ENSP00000358918	0.643	Suppressor of fused homolog
10	9606.ENSP00000376276	0.629	Serine/arginine-rich splicing factor 2
11	9606.ENSP00000011619	0.623	Ran-binding protein 9
12	9606.ENSP00000357798	0.607	Matrix metalloproteinase-21
13	9606.ENSP00000325905	0.591	Serine/arginine-rich splicing factor 7
14	9606.ENSP00000355568	0.591	Interferon regulatory factor 2-binding protein 2
15	9606.ENSP00000374529	0.565	Cyclin-K
16	9606.ENSP00000278568	0.546	Serine/threonine-protein kinase PAK 1
17	9606.ENSP00000261900	0.537	Cyclin-T1
18	9606.ENSP00000258648	0.529	Mediator of RNA polymerase II transcription subunit 4
19	9606.ENSP00000374280	0.505	RNA polymerase-associated protein RTF1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.998	organic cyclic compound binding
GO:0003676	0.992	nucleic acid binding
GO:0005524	0.992	ATP binding
GO:0003723	0.980	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0071704	0.905	organic substance metabolic process
GO:0044238	0.896	primary metabolic process
GO:0006807	0.892	nitrogen compound metabolic process
GO:0044237	0.892	cellular metabolic process
GO:0043170	0.883	macromolecule metabolic process
GO:0019222	0.880	regulation of metabolic process
GO:0060255	0.870	regulation of macromolecule metabolic process
GO:0080090	0.869	regulation of primary metabolic process
GO:0051171	0.869	regulation of nitrogen compound metabolic process
GO:0031323	0.845	regulation of cellular metabolic process
GO:0010468	0.725	regulation of gene expression
GO:0019219	0.704	regulation of nucleobase-containing compound metabolic process
GO:1901564	0.666	organonitrogen compound metabolic process
GO:0051252	0.624	regulation of RNA metabolic process
GO:0043412	0.422	macromolecule modification
GO:0050896	0.405	response to stimulus
GO:0019538	0.381	protein metabolic process
GO:0048518	0.379	positive regulation of biological process
GO:0048519	0.363	negative regulation of biological process
GO:0048523	0.351	negative regulation of cellular process
GO:0016310	0.337	phosphorylation
GO:0048522	0.330	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031974	0.967	membrane-enclosed lumen
GO:0070013	0.960	intracellular organelle lumen
GO:0005737	0.929	cytoplasm
GO:0031981	0.927	nuclear lumen
GO:0005654	0.902	nucleoplasm
GO:0032991	0.830	protein-containing complex
GO:1902494	0.375	catalytic complex
GO:1990234	0.338	transferase complex
GO:0005829	0.311	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]