StarFunc result for job id P21246

User Input

>input (168 residues)
MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSG
DCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTG
SLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21246	1.000	1.000	1.118E-28	168	1.000	1.000	P21246.pdb.gz	PTN_HUMAN Pleiotrophin OS=Homo sapiens OX=9606 GN=PTN PE=1 SV=1
2	AFDB:P48533	0.734	0.762	2.244E-21	161	0.649	0.677	P48533.pdb.gz	PTNB_XENLA Pleiotrophin-B OS=Xenopus laevis OX=8355 GN=ptn-b PE=2 SV=1
3	AFDB:A0A0B5JW32	0.456	0.480	3.664E-18	158	0.560	0.595	A0A0B5JW32.pdb.gz
4	PDB:2n6fA	0.403	0.470	1.971E-16	136	0.810	1.000	2n6fA.pdb.gz
5	AFDB:P48530	0.495	0.575	1.312E-14	142	0.399	0.472	P48530.pdb.gz	MKA_XENLA Midkine-A OS=Xenopus laevis OX=8355 GN=mdk-a PE=2 SV=1
6	AFDB:P21741	0.539	0.623	4.761E-14	143	0.381	0.448	P21741.pdb.gz	MK_HUMAN Midkine OS=Homo sapiens OX=9606 GN=MDK PE=1 SV=1
7	AFDB:A0A0B5JK07	0.447	0.499	1.167E-13	147	0.387	0.442	A0A0B5JK07.pdb.gz
8	AFDB:P12025	0.569	0.672	1.634E-13	140	0.387	0.464	P12025.pdb.gz	MK_MOUSE Midkine OS=Mus musculus OX=10090 GN=Mdk PE=1 SV=2
9	AFDB:A0A1D5NS41	0.336	0.365	7.016E-13	154	0.381	0.416	A0A1D5NS41.pdb.gz
10	PDB:2luuA	0.279	0.357	6.580E-10	127	0.381	0.504	2luuA.pdb.gz
11	PDB:2lutA	0.267	0.352	1.804E-9	125	0.351	0.472	2lutA.pdb.gz
12	AFDB:Q9W0S5	0.220	0.201	1.489E-5	185	0.179	0.162	Q9W0S5.pdb.gz	Q9W0S5_DROME Midkine and pleiotrophin 1, isoform A OS=Drosophila melanogaster OX=7227 GN=miple1 PE=2 SV=2
13	AFDB:M9PDI0	0.261	0.175	3.650E-5	282	0.161	0.096	M9PDI0.pdb.gz	M9PDI0_DROME Midkine and pleiotrophin 2, isoform D OS=Drosophila melanogaster OX=7227 GN=miple2 PE=1 SV=1
14	PDB:4a5wB	0.201	0.046	4.551E-3	871	0.119	0.023	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
15	PDB:4e0sB	0.203	0.045	6.738E-3	898	0.137	0.026	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
16	PDB:3t5oA	0.207	0.047	7.972E-3	871	0.119	0.023	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:1w0rA	0.207	0.087	7.502E-2	442	0.119	0.045	1w0rA.pdb.gz
18	PDB:3figB	0.185	0.069	1.739E-1	577	0.036	0.010	3figB.pdb.gz	Crystal structure of LeuA from Mycobacterium tuberculosis, a key enzyme in leucine biosynthesis.
19	PDB:3ojyB	0.185	0.068	3.046E-1	504	0.048	0.016	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
20	PDB:7nydG	0.172	0.080	3.407E-1	413	0.054	0.022	7nydG.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21246	6.08e-121	339	168	1.000	1.000	PTN_HUMAN Pleiotrophin OS=Homo sapiens OX=9606 GN=PTN PE=1 SV=1
2	P63089	1.55e-118	333	168	0.976	0.976	PTN_MOUSE Pleiotrophin OS=Mus musculus OX=10090 GN=Ptn PE=1 SV=1
3	P63090	1.55e-118	333	168	0.976	0.976	PTN_RAT Pleiotrophin OS=Rattus norvegicus OX=10116 GN=Ptn PE=1 SV=1
4	P32760	8.72e-77	228	165	0.720	0.733	PTN_CHICK Pleiotrophin OS=Gallus gallus OX=9031 GN=PTN PE=1 SV=2
5	P48533	5.43e-64	195	161	0.613	0.640	PTNB_XENLA Pleiotrophin-B OS=Xenopus laevis OX=8355 GN=ptn-b PE=2 SV=1
6	Q502U6	5.44e-64	195	158	0.589	0.627	Q502U6_DANRE Pleiotrophin OS=Danio rerio OX=7955 GN=zHBNF PE=1 SV=1
7	P48530	1.36e-38	130	142	0.381	0.451	MKA_XENLA Midkine-A OS=Xenopus laevis OX=8355 GN=mdk-a PE=2 SV=1
8	Q9DDG2	6.58e-38	129	147	0.375	0.429	Q9DDG2_DANRE Midkine b OS=Danio rerio OX=7955 GN=mdk2 PE=1 SV=1
9	Q9W767	6.92e-37	126	146	0.351	0.404	Q9W767_DANRE Midkine a OS=Danio rerio OX=7955 GN=zgc:86655 PE=1 SV=1
10	P12025	5.20e-33	116	140	0.304	0.364	MK_MOUSE Midkine OS=Mus musculus OX=10090 GN=Mdk PE=1 SV=2
11	Q9R1S9	5.32e-33	116	140	0.304	0.364	MK_RAT Midkine OS=Rattus norvegicus OX=10116 GN=Mdk PE=2 SV=1
12	P21741	6.25e-33	116	143	0.304	0.357	MK_HUMAN Midkine OS=Homo sapiens OX=9606 GN=MDK PE=1 SV=1
13	Q9W0S5	0.026	36.2	185	0.119	0.108	Q9W0S5_DROME Midkine and pleiotrophin 1, isoform A OS=Drosophila melanogaster OX=7227 GN=miple1 PE=2 SV=2
14	Q9Y0V9	0.029	35.8	185	0.119	0.108	Q9Y0V9_DROME Miple OS=Drosophila melanogaster OX=7227 GN=miple1 PE=2 SV=2
15	M9PE21	0.030	36.2	281	0.113	0.068	M9PE21_DROME Midkine and pleiotrophin 2, isoform E OS=Drosophila melanogaster OX=7227 GN=miple2 PE=1 SV=1
16	Q9U3W4	0.031	36.2	279	0.107	0.065	Q9U3W4_DROME Miple2 OS=Drosophila melanogaster OX=7227 GN=miple2 PE=2 SV=1
17	Q9W0S4	0.031	36.2	279	0.107	0.065	Q9W0S4_DROME FI07208p OS=Drosophila melanogaster OX=7227 GN=miple2 PE=1 SV=1
18	Q8SZ83	0.032	36.2	279	0.107	0.065	Q8SZ83_DROME RE13914p OS=Drosophila melanogaster OX=7227 GN=miple2 PE=2 SV=1
19	M9PDI0	0.033	36.2	282	0.107	0.064	M9PDI0_DROME Midkine and pleiotrophin 2, isoform D OS=Drosophila melanogaster OX=7227 GN=miple2 PE=1 SV=1
20	Q5ND28	0.93	32.0	820	0.095	0.020	SREC_MOUSE Scavenger receptor class F member 1 OS=Mus musculus OX=10090 GN=Scarf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01091 PTN_MK_C	1.9e-23	93.9	PTN/MK heparin-binding protein family, C-terminal domain
2	PF05196 PTN_MK_N	1.5e-23	94.0	PTN/MK heparin-binding protein family, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000005158

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000016985	0.926	Cell surface proteoglycan
2	60711.ENSCSAP00000006831	0.886	Protein tyrosine phosphatase, receptor-type, Z polypeptide 1
3	60711.ENSCSAP00000007009	0.824	Anaplastic lymphoma receptor tyrosine kinase
4	60711.ENSCSAP00000004340	0.756	Cell surface proteoglycan
5	60711.ENSCSAP00000000527	0.749	Protein tyrosine phosphatase, receptor type, B
6	60711.ENSCSAP00000009855	0.718	Tyrosine-protein kinase
7	60711.ENSCSAP00000005943	0.674	Bone morphogenetic protein receptor, type IA
8	60711.ENSCSAP00000005615	0.669	Cortactin
9	60711.ENSCSAP00000018793	0.666	Transducer of ERBB2, 2
10	60711.ENSCSAP00000008502	0.660	Strawberry notch homolog 2 (Drosophila)
11	60711.ENSCSAP00000010870	0.631	Myocyte enhancer factor 2C
12	60711.ENSCSAP00000008236	0.628	Protein tyrosine phosphatase, receptor type, G
13	60711.ENSCSAP00000003543	0.602	Hematopoietic cell-specific Lyn substrate 1
14	60711.ENSCSAP00000013643	0.598	Tyrosine-protein kinase
15	60711.ENSCSAP00000009263	0.595	Leucine rich repeat transmembrane neuronal 2
16	60711.ENSCSAP00000001026	0.586	Spondin 1, extracellular matrix protein
17	60711.ENSCSAP00000016591	0.568	Cysteine-rich, angiogenic inducer, 61
18	60711.ENSCSAP00000000061	0.556	Discs, large homolog 2 (Drosophila)
19	60711.ENSCSAP00000009564	0.555	Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released
20	60711.ENSCSAP00000018944	0.555	Leucine rich repeat transmembrane neuronal 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity
GO:0008201	0.996	heparin binding
GO:0019899	0.712	enzyme binding
GO:0030234	0.691	enzyme regulator activity
GO:0050839	0.635	cell adhesion molecule binding
GO:0019208	0.620	phosphatase regulator activity
GO:0019212	0.614	phosphatase inhibitor activity
GO:0005178	0.592	integrin binding
GO:0019888	0.586	protein phosphatase regulator activity
GO:0019900	0.575	kinase binding
GO:0004864	0.559	protein phosphatase inhibitor activity
GO:0019901	0.514	protein kinase binding
GO:0030246	0.482	carbohydrate binding
GO:0035374	0.340	chondroitin sulfate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0009987	0.986	cellular process
GO:0048856	0.986	anatomical structure development
GO:0050793	0.985	regulation of developmental process
GO:0051239	0.981	regulation of multicellular organismal process
GO:0048731	0.981	system development
GO:0048522	0.976	positive regulation of cellular process
GO:0051960	0.969	regulation of nervous system development
GO:0050896	0.963	response to stimulus
GO:0051094	0.963	positive regulation of developmental process
GO:0045595	0.957	regulation of cell differentiation
GO:0040012	0.946	regulation of locomotion
GO:0048513	0.939	animal organ development
GO:0030334	0.933	regulation of cell migration
GO:0051716	0.930	cellular response to stimulus
GO:0007399	0.920	nervous system development
GO:0042127	0.907	regulation of cell population proliferation
GO:0045597	0.907	positive regulation of cell differentiation
GO:0051240	0.901	positive regulation of multicellular organismal process
GO:0050767	0.898	regulation of neurogenesis
GO:0014013	0.894	regulation of gliogenesis
GO:0050678	0.881	regulation of epithelial cell proliferation
GO:0030278	0.868	regulation of ossification
GO:0009888	0.858	tissue development
GO:0050679	0.857	positive regulation of epithelial cell proliferation
GO:0007154	0.852	cell communication
GO:0071363	0.846	cellular response to growth factor stimulus
GO:0030335	0.844	positive regulation of cell migration
GO:0023056	0.840	positive regulation of signaling
GO:0070887	0.835	cellular response to chemical stimulus
GO:0048519	0.814	negative regulation of biological process
GO:0031346	0.803	positive regulation of cell projection organization
GO:1901342	0.792	regulation of vasculature development
GO:0048523	0.789	negative regulation of cellular process
GO:0051241	0.785	negative regulation of multicellular organismal process
GO:0032101	0.784	regulation of response to external stimulus
GO:0022603	0.781	regulation of anatomical structure morphogenesis
GO:0010721	0.774	negative regulation of cell development
GO:0010976	0.772	positive regulation of neuron projection development
GO:0009653	0.758	anatomical structure morphogenesis
GO:0048869	0.757	cellular developmental process
GO:0071840	0.740	cellular component organization or biogenesis
GO:0016043	0.734	cellular component organization
GO:0010646	0.733	regulation of cell communication
GO:0007166	0.733	cell surface receptor signaling pathway
GO:0030154	0.730	cell differentiation
GO:0048584	0.721	positive regulation of response to stimulus
GO:0009628	0.679	response to abiotic stimulus
GO:0050890	0.678	cognition
GO:0006950	0.672	response to stress
GO:0048468	0.671	cell development
GO:0065008	0.667	regulation of biological quality
GO:0022008	0.667	neurogenesis
GO:0032103	0.658	positive regulation of response to external stimulus
GO:0019222	0.634	regulation of metabolic process
GO:0051179	0.631	localization
GO:0008285	0.626	negative regulation of cell population proliferation
GO:0048167	0.609	regulation of synaptic plasticity
GO:0050768	0.598	negative regulation of neurogenesis
GO:0009605	0.577	response to external stimulus
GO:0001503	0.563	ossification
GO:0060429	0.557	epithelium development
GO:0030182	0.547	neuron differentiation
GO:0048666	0.541	neuron development
GO:0048771	0.532	tissue remodeling
GO:0060255	0.484	regulation of macromolecule metabolic process
GO:0010647	0.452	positive regulation of cell communication
GO:0031323	0.421	regulation of cellular metabolic process
GO:0010468	0.421	regulation of gene expression
GO:0009893	0.407	positive regulation of metabolic process
GO:0022414	0.390	reproductive process
GO:0045687	0.374	positive regulation of glial cell differentiation
GO:0080090	0.366	regulation of primary metabolic process
GO:0051171	0.348	regulation of nitrogen compound metabolic process
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0009889	0.334	regulation of biosynthetic process
GO:0048713	0.302	regulation of oligodendrocyte differentiation
GO:0010556	0.301	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.995	cell periphery
GO:0005737	0.962	cytoplasm
GO:0043226	0.951	organelle
GO:0043227	0.942	membrane-bounded organelle
GO:0005886	0.922	plasma membrane
GO:0043231	0.914	intracellular membrane-bounded organelle
GO:0012505	0.875	endomembrane system
GO:0032991	0.608	protein-containing complex
GO:0005615	0.558	extracellular space
GO:0030054	0.544	cell junction
GO:0031012	0.531	extracellular matrix
GO:0070013	0.429	intracellular organelle lumen
GO:0045202	0.369	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]