StarFunc result for job id P21281

User Input

>input (511 residues)
MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVIL
DHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILR
TPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGM
NSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMET
ARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDM
SSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDD
ITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN
QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFERNFIAQGPYENRTVFETLDIG
WQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK65	0.941	0.941	1.320E-99	511	1.000	1.000	A0A140VK65.pdb.gz	A0A140VK65_HUMAN Vacuolar proton pump subunit B OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:D3ZZS8	0.949	0.794	1.584E-92	611	0.841	0.704	D3ZZS8.pdb.gz	D3ZZS8_RAT Vacuolar proton pump subunit B OS=Rattus norvegicus OX=10116 GN=Atp6v1b1 PE=3 SV=3
3	AFDB:P31409	0.953	0.994	1.979E-92	490	0.855	0.892	P31409.pdb.gz	VATB_DROME V-type proton ATPase subunit B OS=Drosophila melanogaster OX=7227 GN=Vha55 PE=2 SV=1
4	AFDB:Q19626	0.952	0.990	3.306E-90	491	0.802	0.835	Q19626.pdb.gz	VATB1_CAEEL V-type proton ATPase subunit B 1 OS=Caenorhabditis elegans OX=6239 GN=vha-12 PE=1 SV=1
5	AFDB:Q76NU1	0.946	0.980	7.710E-88	493	0.730	0.757	Q76NU1.pdb.gz	VATB_DICDI V-type proton ATPase subunit B OS=Dictyostelium discoideum OX=44689 GN=vatB PE=1 SV=1
6	AFDB:P31411	0.944	0.959	9.426E-87	503	0.730	0.742	P31411.pdb.gz	VATB_SCHPO V-type proton ATPase subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vma2 PE=1 SV=2
7	AFDB:Q9N5A0	0.937	0.956	2.171E-86	501	0.748	0.762	Q9N5A0.pdb.gz	VATB2_CAEEL V-type proton ATPase subunit B 2 OS=Caenorhabditis elegans OX=6239 GN=spe-5 PE=1 SV=1
8	AFDB:P16140	0.927	0.916	9.224E-86	517	0.746	0.737	P16140.pdb.gz	VATB_YEAST V-type proton ATPase subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA2 PE=1 SV=2
9	AFDB:Q6ZMA8	0.925	0.957	7.226E-85	494	0.701	0.725	Q6ZMA8.pdb.gz	Q6ZMA8_PLAF7 Vacuolar proton pump subunit B OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0406100 PE=3 SV=1
10	PDB:7u4tE	0.894	0.975	6.690E-84	468	0.916	1.000	7u4tE.pdb.gz	Identification of mEAK-7 as a human V-ATPase regulator via cryo-EM data mining.
11	AFDB:F4JTQ0	0.907	0.938	3.967E-83	494	0.724	0.749	F4JTQ0.pdb.gz	F4JTQ0_ARATH Vacuolar proton pump subunit B OS=Arabidopsis thaliana OX=3702 GN=VAB2 PE=1 SV=1
12	PDB:7tmrF	0.900	0.961	1.341E-74	478	0.746	0.797	7tmrF.pdb.gz	Coordinated conformational changes in the V 1 complex during V-ATPase reversible dissociation.
13	PDB:5ze9F	0.868	0.971	1.629E-65	456	0.505	0.566	5ze9F.pdb.gz	Metastable asymmetrical structure of a shaftless V1motor.
14	PDB:7valF	0.877	0.951	1.580E-61	471	0.497	0.539	7valF.pdb.gz	Structural snapshots of V/A-ATPase reveal the rotary catalytic mechanism of rotary ATPases.
15	PDB:5b0oB	0.746	0.832	2.833E-34	455	0.215	0.242	5b0oB.pdb.gz	Insight into the flagella type III export revealed by the complex structure of the type III ATPase and its regulator
16	PDB:6cp3C	0.752	0.757	3.032E-32	508	0.213	0.215	6cp3C.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.
17	PDB:6oqsB	0.762	0.759	5.592E-32	513	0.207	0.207	6oqsB.pdb.gz	Cryo-EM structures provide insight into how E. coli F1FoATP synthase accommodates symmetry mismatch.
18	PDB:2wpdE	0.714	0.767	2.511E-31	473	0.215	0.233	2wpdE.pdb.gz	Crystal Structure of the Mg.Adp-Inhibited State of the Yeast F1C10-ATP Synthase.
19	PDB:2wssA	0.756	0.757	6.116E-31	510	0.213	0.214	2wssA.pdb.gz	The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
20	PDB:6f5dF	0.762	0.797	6.689E-30	488	0.205	0.215	6f5dF.pdb.gz	ATP synthase fromTrypanosoma bruceihas an elaborated canonical F1-domain and conventional catalytic sites.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A140VK65	1055	511	1.000	1.000	A0A140VK65_HUMAN Vacuolar proton pump subunit B OS=Homo sapiens OX=9606 PE=2 SV=1
2	A0A8I6AHZ0	826	480	0.783	0.833	A0A8I6AHZ0_RAT Vacuolar proton pump subunit B OS=Rattus norvegicus OX=10116 GN=Atp6v1b1 PE=3 SV=1
3	A8AAA9	540	471	0.507	0.550	VATB_IGNH4 V-type ATP synthase beta chain OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) OX=453591 GN=atpB PE=1 SV=1
4	D3ZZS8	896	513	0.832	0.828	D3ZZS8_RAT Vacuolar proton pump subunit B OS=Rattus norvegicus OX=10116 GN=Atp6v1b1 PE=3 SV=3
5	F4JTQ0	776	494	0.728	0.753	F4JTQ0_ARATH Vacuolar proton pump subunit B OS=Arabidopsis thaliana OX=3702 GN=VAB2 PE=1 SV=1
6	P11574	778	486	0.730	0.767	VATB1_ARATH V-type proton ATPase subunit B1 OS=Arabidopsis thaliana OX=3702 GN=VHA-B1 PE=2 SV=2
7	P15313	902	513	0.838	0.834	VATB1_HUMAN V-type proton ATPase subunit B, kidney isoform OS=Homo sapiens OX=9606 GN=ATP6V1B1 PE=1 SV=3
8	P16140	795	517	0.744	0.735	VATB_YEAST V-type proton ATPase subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA2 PE=1 SV=2
9	P21281	1055	511	1.000	1.000	VATB2_HUMAN V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3
10	P31408	1047	511	0.990	0.990	VATB2_BOVIN V-type proton ATPase subunit B, brain isoform OS=Bos taurus OX=9913 GN=ATP6V1B2 PE=1 SV=3
11	P31409	900	490	0.855	0.892	VATB_DROME V-type proton ATPase subunit B OS=Drosophila melanogaster OX=7227 GN=Vha55 PE=2 SV=1
12	P31411	786	503	0.728	0.740	VATB_SCHPO V-type proton ATPase subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vma2 PE=1 SV=2
13	P62814	1048	511	0.990	0.990	VATB2_MOUSE V-type proton ATPase subunit B, brain isoform OS=Mus musculus OX=10090 GN=Atp6v1b2 PE=1 SV=1
14	P62815	1048	511	0.990	0.990	VATB2_RAT V-type proton ATPase subunit B, brain isoform OS=Rattus norvegicus OX=10116 GN=Atp6v1b2 PE=1 SV=1
15	Q08637	543	458	0.505	0.563	NTPB_ENTHA V-type sodium ATPase subunit B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=ntpB PE=1 SV=1
16	Q19626	852	491	0.802	0.835	VATB1_CAEEL V-type proton ATPase subunit B 1 OS=Caenorhabditis elegans OX=6239 GN=vha-12 PE=1 SV=1
17	Q383B1	732	495	0.689	0.711	Q383B1_TRYB2 Vacuolar proton pump subunit B OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3560 PE=3 SV=1
18	Q59HF3	639	319	0.609	0.975	Q59HF3_HUMAN ATPase, H+ transporting, lysosomal 56/58kD, V1 subunit B, isoform 2 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
19	Q59PT0	796	512	0.736	0.734	VATB_CANAL V-type proton ATPase subunit B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VMA2 PE=3 SV=1
20	Q6ZMA8	759	494	0.697	0.721	Q6ZMA8_PLAF7 Vacuolar proton pump subunit B OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0406100 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00006 ATP-synt_ab	5e-61	217.6	ATP synthase alpha/beta family, nucleotide-binding domain
2	PF02874 ATP-synt_ab_N	6.4e-10	50.7	ATP synthase alpha/beta family, beta-barrel domain
3	PF10654 DUF2481	6.7e+02	11.7	Protein of unknown function (DUF2481)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000988

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000748	0.999	ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D
2	61853.ENSNLEP00000004480	0.999	V-type proton ATPase subunit C
3	61853.ENSNLEP00000005658	0.999	ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A
4	61853.ENSNLEP00000001105	0.998	ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H
5	61853.ENSNLEP00000007393	0.997	V-type proton ATPase subunit G
6	61853.ENSNLEP00000009535	0.997	Uncharacterized protein
7	61853.ENSNLEP00000020443	0.996	V-type proton ATPase subunit G
8	61853.ENSNLEP00000015104	0.995	V-type proton ATPase subunit F
9	61853.ENSNLEP00000014043	0.994	V-type proton ATPase subunit a
10	61853.ENSNLEP00000005718	0.993	V-type proton ATPase subunit
11	61853.ENSNLEP00000020548	0.993	ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2
12	61853.ENSNLEP00000011461	0.991	V-type proton ATPase proteolipid subunit
13	61853.ENSNLEP00000017262	0.990	ATPase, H+ transporting, lysosomal accessory protein 1
14	61853.ENSNLEP00000001824	0.987	ATPase, H+ transporting, lysosomal accessory protein 2
15	61853.ENSNLEP00000016892	0.987	ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b
16	61853.ENSNLEP00000023117	0.978	V-type proton ATPase subunit F
17	61853.ENSNLEP00000001755	0.977	V-type proton ATPase subunit
18	61853.ENSNLEP00000012482	0.972	ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1
19	61853.ENSNLEP00000016884	0.966	V-type proton ATPase subunit C
20	61853.ENSNLEP00000016928	0.963	V-type proton ATPase subunit a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046961	0.999	proton-transporting ATPase activity, rotational mechanism
GO:0003824	0.383	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.995	localization
GO:0065007	0.990	biological regulation
GO:1902600	0.977	proton transmembrane transport
GO:0055080	0.871	monoatomic cation homeostasis
GO:0006885	0.801	regulation of pH
GO:0050789	0.560	regulation of biological process
GO:0050794	0.512	regulation of cellular process
GO:0019725	0.484	cellular homeostasis
GO:0008152	0.355	metabolic process
GO:0044237	0.335	cellular metabolic process
GO:0050896	0.331	response to stimulus
GO:0055082	0.308	intracellular chemical homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.996	membrane
GO:0005737	0.996	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0032991	0.992	protein-containing complex
GO:0031090	0.992	organelle membrane
GO:0005829	0.991	cytosol
GO:0012505	0.990	endomembrane system
GO:0031982	0.975	vesicle
GO:0005576	0.972	extracellular region
GO:0005774	0.969	vacuolar membrane
GO:0005764	0.963	lysosome
GO:0071944	0.959	cell periphery
GO:0005765	0.951	lysosomal membrane
GO:0070062	0.947	extracellular exosome
GO:0005886	0.938	plasma membrane
GO:1902494	0.925	catalytic complex
GO:0098796	0.924	membrane protein complex
GO:0016469	0.911	proton-transporting two-sector ATPase complex
GO:0030659	0.821	cytoplasmic vesicle membrane
GO:0033176	0.782	proton-transporting V-type ATPase complex
GO:0033178	0.774	proton-transporting two-sector ATPase complex, catalytic domain
GO:0000221	0.764	vacuolar proton-transporting V-type ATPase, V1 domain
GO:0045177	0.698	apical part of cell
GO:0098590	0.499	plasma membrane region
GO:0031981	0.333	nuclear lumen
GO:0099503	0.325	secretory vesicle
GO:0030054	0.310	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:57721	0.999	ATP + 4 H(+)(in) + H2O => ADP + 5 H(+)(out) + phosphate

[back to server]