StarFunc result for job id P21333

User Input

>input (2647 residues)
MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV
EPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JXT8	0.331	0.335	0.000	2602	0.683	0.695	A0A0G2JXT8.pdb.gz	A0A0G2JXT8_RAT Filamin B OS=Rattus norvegicus OX=10116 GN=Flnb PE=1 SV=1
2	AFDB:P21333	1.000	1.000	0.000	2647	1.000	1.000	P21333.pdb.gz	FLNA_HUMAN Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4
3	AFDB:Q9VEN1	0.190	0.217	0.000	2210	0.418	0.500	Q9VEN1.pdb.gz	FLNA_DROME Filamin-A OS=Drosophila melanogaster OX=7227 GN=cher PE=1 SV=2
4	AFDB:U4PBJ9	0.174	0.201	0.000	2259	0.304	0.356	U4PBJ9.pdb.gz	U4PBJ9_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
5	AFDB:Q9TYW4	0.131	0.295	4.958E-83	1084	0.133	0.326	Q9TYW4.pdb.gz	Q9TYW4_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
6	AFDB:Q95U66	0.086	0.161	2.590E-81	1148	0.108	0.249	Q95U66.pdb.gz	Q95U66_DROME GH03118p OS=Drosophila melanogaster OX=7227 GN=jbug PE=2 SV=1
7	AFDB:P13466	0.081	0.246	2.149E-59	857	0.094	0.292	P13466.pdb.gz	GELA_DICDI Gelation factor OS=Dictyostelium discoideum OX=44689 GN=abpC PE=1 SV=1
8	AFDB:P76347	0.094	0.101	2.296E-41	2358	0.104	0.117	P76347.pdb.gz	YEEJ_ECOLI Uncharacterized protein YeeJ OS=Escherichia coli (strain K12) OX=83333 GN=yeeJ PE=3 SV=3
9	AFDB:Q961W2	0.079	0.215	1.561E-34	713	0.048	0.177	Q961W2.pdb.gz	Q961W2_DROME GH03013p OS=Drosophila melanogaster OX=7227 GN=jbug PE=2 SV=1
10	AFDB:Q4VA61	0.073	0.085	1.212E-30	2053	0.073	0.094	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
11	PDB:7sqcO0	0.060	0.098	2.556E-18	1140	0.048	0.111	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:1e07A	0.062	0.188	1.131E-15	642	0.026	0.107	1e07A.pdb.gz
13	PDB:4lnvA	0.058	0.091	7.764E-14	1276	0.039	0.082	4lnvA.pdb.gz
14	PDB:5a42A	0.050	0.069	2.902E-13	1597	0.048	0.080	5a42A.pdb.gz
15	PDB:7q1yA	0.056	0.090	3.326E-13	1374	0.040	0.076	7q1yA.pdb.gz
16	PDB:7q5zA	0.051	0.084	1.243E-12	1344	0.050	0.098	7q5zA.pdb.gz
17	PDB:5oj2B	0.079	0.194	2.574E-12	692	0.039	0.149	5oj2B.pdb.gz
18	PDB:4d1eA	0.080	0.241	1.054E-11	859	0.032	0.098	4d1eA.pdb.gz
19	PDB:7nycA	0.049	0.073	1.103E-11	1542	0.039	0.066	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:4aq1A	0.044	0.126	2.865E-11	721	0.034	0.125	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JXT8	3720	2602	0.685	0.697	A0A0G2JXT8_RAT Filamin B OS=Rattus norvegicus OX=10116 GN=Flnb PE=1 SV=1
2	A0A0R4IUS4	1427	2702	0.359	0.352	A0A0R4IUS4_DANRE Filamin C, gamma a (actin-binding protein 280) OS=Danio rerio OX=7955 GN=flnca PE=1 SV=1
3	A0A8I5Y6H8	4860	2450	0.900	0.972	A0A8I5Y6H8_RAT Filamin A OS=Rattus norvegicus OX=10116 GN=Flna PE=1 SV=1
4	A0A8I5Y7V6	1751	2537	0.410	0.427	A0A8I5Y7V6_RAT Filamin A OS=Rattus norvegicus OX=10116 GN=Flna PE=1 SV=1
5	A0A8I5ZV49	5269	2647	0.974	0.974	A0A8I5ZV49_RAT Filamin A OS=Rattus norvegicus OX=10116 GN=Flna PE=1 SV=1
6	A0A8I6GK95	3613	2556	0.671	0.694	A0A8I6GK95_RAT Filamin B OS=Rattus norvegicus OX=10116 GN=Flnb PE=1 SV=1
7	D0IMZ5	867	2255	0.229	0.269	D0IMZ5_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
8	D0IMZ6	691	836	0.138	0.437	D0IMZ6_CAEEL FiLamiN (Actin binding protein) homolog OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
9	D0IMZ7	731	2204	0.241	0.289	D0IMZ7_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
10	D0IMZ8	728	2206	0.241	0.289	D0IMZ8_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
11	D3ZHA0	1504	2726	0.366	0.355	FLNC_RAT Filamin-C OS=Rattus norvegicus OX=10116 GN=Flnc PE=1 SV=1
12	D4A8D5	3704	2578	0.683	0.702	D4A8D5_RAT Filamin B OS=Rattus norvegicus OX=10116 GN=Flnb PE=1 SV=1
13	E7EN95	3360	2409	0.628	0.690	E7EN95_HUMAN Filamin B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=1
14	O75369	3724	2602	0.690	0.702	FLNB_HUMAN Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2
15	P21333	5395	2647	1.000	1.000	FLNA_HUMAN Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4
16	Q14315	1496	2725	0.363	0.353	FLNC_HUMAN Filamin-C OS=Homo sapiens OX=9606 GN=FLNC PE=1 SV=3
17	Q60FE5	5343	2620	0.990	1.000	Q60FE5_HUMAN Filamin A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=1
18	Q80X90	3714	2602	0.683	0.695	FLNB_MOUSE Filamin-B OS=Mus musculus OX=10090 GN=Flnb PE=1 SV=3
19	Q8BTM8	5275	2647	0.973	0.973	FLNA_MOUSE Filamin-A OS=Mus musculus OX=10090 GN=Flna PE=1 SV=5
20	Q8VHX6	1505	2726	0.366	0.355	FLNC_MOUSE Filamin-C OS=Mus musculus OX=10090 GN=Flnc PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16640 Big_3_5	9.2e-08	43.5	Bacterial Ig-like domain (group 3)
2	PF11971 CAMSAP_CH	97	14.2	CAMSAP CH domain
3	PF19079 CFSR	1.1e-05	37.0	Collagen-flanked surface repeat
4	PF00307 CH	2.6e-35	132.3	Calponin homology (CH) domain
5	PF06294 CH_2	4.2e+02	12.4	CH-like domain in sperm protein
6	PF16586 DUF5060	1.3e-09	49.7	Domain of unknown function (DUF5060)
7	PF01105 EMP24_GP25L	0.43	22.0	emp24/gp25L/p24 family/GOLD
8	PF00630 Filamin	0	1281.4	Filamin/ABP280 repeat
9	PF13954 PapC_N	5.7	18.4	PapC N-terminal domain
10	PF13115 YtkA	0.00019	33.3	YtkA-like
11	PF07495 Y_Y_Y	1.7e-12	58.4	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358866

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329380	0.999	Platelet glycoprotein Ib alpha chain
2	9606.ENSP00000379350	0.998	Integrin beta-1
3	9606.ENSP00000416387	0.998	Filamin-binding LIM protein 1
4	9606.ENSP00000267082	0.997	Integrin beta-7
5	9606.ENSP00000378611	0.994	Rho GTPase-activating protein 24
6	9606.ENSP00000363822	0.993	Androgen receptor
7	9606.ENSP00000339191	0.990	Caveolin-1
8	9606.ENSP00000420194	0.988	Extracellular calcium-sensing receptor
9	9606.ENSP00000211998	0.986	Vinculin
10	9606.ENSP00000310305	0.985	P2Y purinoceptor 2
11	9606.ENSP00000452786	0.983	Integrin beta-3
12	9606.ENSP00000420213	0.979	Filamin-B
13	9606.ENSP00000316029	0.972	Talin-1
14	9606.ENSP00000278568	0.970	Serine/threonine-protein kinase PAK 1
15	9606.ENSP00000324890	0.968	T-cell-specific surface glycoprotein CD28
16	9606.ENSP00000263125	0.966	Protein kinase C theta type
17	9606.ENSP00000369497	0.965	Breast cancer type 2 susceptibility protein
18	9606.ENSP00000262407	0.963	Integrin alpha-IIb
19	9606.ENSP00000234313	0.957	Pleckstrin
20	9606.ENSP00000467141	0.951	Titin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.998	protein-containing complex binding
GO:0008092	0.997	cytoskeletal protein binding
GO:0003779	0.978	actin binding
GO:0098772	0.973	molecular function regulator activity
GO:0019900	0.969	kinase binding
GO:0003723	0.963	RNA binding
GO:0042802	0.957	identical protein binding
GO:0015459	0.953	potassium channel regulator activity
GO:0050839	0.877	cell adhesion molecule binding
GO:0045296	0.858	cadherin binding
GO:0005102	0.848	signaling receptor binding
GO:0046983	0.820	protein dimerization activity
GO:0042803	0.784	protein homodimerization activity
GO:0051015	0.764	actin filament binding
GO:0046332	0.611	SMAD binding
GO:0034987	0.558	immunoglobulin receptor binding
GO:0034988	0.553	Fc-gamma receptor I complex binding
GO:0044325	0.541	transmembrane transporter binding
GO:0008134	0.480	transcription factor binding
GO:0031267	0.476	small GTPase binding
GO:0001664	0.464	G protein-coupled receptor binding
GO:0140297	0.462	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.975	cellular process
GO:0050794	0.970	regulation of cellular process
GO:0032231	0.955	regulation of actin filament bundle assembly
GO:0048518	0.954	positive regulation of biological process
GO:0048522	0.944	positive regulation of cellular process
GO:0007275	0.939	multicellular organism development
GO:0009299	0.933	mRNA transcription
GO:0048731	0.922	system development
GO:0007548	0.919	sex differentiation
GO:0040017	0.916	positive regulation of locomotion
GO:1902414	0.911	protein localization to cell junction
GO:0048513	0.909	animal organ development
GO:0051130	0.906	positive regulation of cellular component organization
GO:0030154	0.905	cell differentiation
GO:2001222	0.905	regulation of neuron migration
GO:0030902	0.903	hindbrain development
GO:2000177	0.902	regulation of neural precursor cell proliferation
GO:0008584	0.899	male gonad development
GO:0030335	0.898	positive regulation of cell migration
GO:0021543	0.892	pallium development
GO:0021535	0.892	cell migration in hindbrain
GO:0042789	0.892	mRNA transcription by RNA polymerase II
GO:0050896	0.885	response to stimulus
GO:0021987	0.874	cerebral cortex development
GO:1902905	0.860	positive regulation of supramolecular fiber organization
GO:0032233	0.835	positive regulation of actin filament bundle assembly
GO:0071840	0.827	cellular component organization or biogenesis
GO:0016043	0.822	cellular component organization
GO:0051716	0.806	cellular response to stimulus
GO:2001224	0.797	positive regulation of neuron migration
GO:0048468	0.773	cell development
GO:2000179	0.742	positive regulation of neural precursor cell proliferation
GO:0009653	0.720	anatomical structure morphogenesis
GO:0009888	0.687	tissue development
GO:0007165	0.679	signal transduction
GO:0002064	0.621	epithelial cell development
GO:0048519	0.571	negative regulation of biological process
GO:0048583	0.554	regulation of response to stimulus
GO:0048523	0.554	negative regulation of cellular process
GO:0051171	0.516	regulation of nitrogen compound metabolic process
GO:0031323	0.513	regulation of cellular metabolic process
GO:0080090	0.502	regulation of primary metabolic process
GO:0060255	0.451	regulation of macromolecule metabolic process
GO:0006950	0.418	response to stress
GO:0042221	0.383	response to chemical
GO:0007166	0.366	cell surface receptor signaling pathway
GO:0048584	0.318	positive regulation of response to stimulus
GO:0006996	0.315	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0005856	0.999	cytoskeleton
GO:0030054	0.996	cell junction
GO:0005886	0.994	plasma membrane
GO:0005634	0.993	nucleus
GO:0015629	0.991	actin cytoskeleton
GO:0099080	0.942	supramolecular complex
GO:0099081	0.926	supramolecular polymer
GO:0031982	0.914	vesicle
GO:0099512	0.909	supramolecular fiber
GO:0042995	0.871	cell projection
GO:0043005	0.863	neuron projection
GO:0070161	0.826	anchoring junction
GO:0005576	0.795	extracellular region
GO:0030055	0.790	cell-substrate junction
GO:0036477	0.756	somatodendritic compartment
GO:0005925	0.718	focal adhesion
GO:0044297	0.717	cell body
GO:0005615	0.671	extracellular space
GO:0030425	0.632	dendrite
GO:0043198	0.623	dendritic shaft
GO:0070062	0.590	extracellular exosome
GO:0031981	0.541	nuclear lumen
GO:0032991	0.481	protein-containing complex
GO:0099513	0.386	polymeric cytoskeletal fiber
GO:0031523	0.371	Myb complex
GO:0045202	0.366	synapse
GO:0098794	0.363	postsynapse
GO:0048471	0.346	perinuclear region of cytoplasm
GO:0005884	0.342	actin filament
GO:0005938	0.337	cell cortex
GO:0012505	0.324	endomembrane system
GO:0005730	0.320	nucleolus
GO:0005911	0.316	cell-cell junction
GO:0005654	0.316	nucleoplasm
GO:0098978	0.314	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]