StarFunc result for job id P21359

User Input

>input (1400 residues)
MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTT
ILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHF
LHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELL
QYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQT
DMAECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDENNMNKKLFL
DSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNP
SKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITN
SALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTSLKFKEK
PTDLETRSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGSTAELITGLVQLVPQSHMPE
IAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEILKWL
REILICRNKFLLKNKQADRSSCHFLLFYGVGCDIPSSGNTSQMSMDHEELLRTPGASLRK
GKGNSSMDSAAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCEEADIR
CGVDEVSVHNLLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPTAGNTEAWEDT
HAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINM
TGFLCALGGVCLQQRSNSGLATYSPPMGPVSERKGSMISVMSSEGNADTPVSKFMDRLLS
LMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQF
VEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHAIQIKTKLCQLVE
VMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDLDQASMEAVVSLL
AGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDESAQTGGRKRGMSRRLAS
LRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETV
LADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNM
FSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVITSSDWQHVSFE
VDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPPQLRSVCHCLYQATCHSLLNKA
TVKEKKENKKSVVSQRFPQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mp5A	0.609	0.526	0.000	1629	0.759	0.652	7mp5A.pdb.gz
2	PDB:7pgrN	0.690	0.408	0.000	2423	0.869	0.502	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
3	PDB:7r04A	0.672	0.410	9.536E-99	2326	0.827	0.498	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
4	PDB:7pgsN	0.689	0.545	1.144E-95	1787	0.748	0.586	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
5	PDB:7r04B	0.669	0.428	5.042E-95	2229	0.806	0.507	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
6	PDB:7r03B	0.649	0.412	2.044E-92	2246	0.809	0.504	7r03B.pdb.gz
7	PDB:7mp6B	0.610	0.533	3.123E-87	1609	0.656	0.571	7mp6B.pdb.gz
8	AFDB:Q9HDV6	0.327	0.241	5.884E-13	2196	0.140	0.089	Q9HDV6.pdb.gz	MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1
9	AFDB:Q93VS8	0.186	0.217	2.893E-9	1116	0.125	0.157	Q93VS8.pdb.gz	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
10	PDB:7mqaSP	0.121	0.083	5.828E-8	2485	0.121	0.068	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	AFDB:Q385W6	0.190	0.158	9.323E-8	1789	0.113	0.088	Q385W6.pdb.gz	Q385W6_TRYB2 Sister chromatid cohesion protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2090 PE=3 SV=1
12	PDB:7mqaLM	0.121	0.097	1.118E-7	2041	0.136	0.093	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:Q42510	0.162	0.159	1.339E-7	1451	0.119	0.114	Q42510.pdb.gz	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
14	PDB:6x9oA	0.248	0.160	1.855E-7	2425	0.129	0.075	6x9oA.pdb.gz
15	AFDB:Q9C0Z4	0.151	0.134	2.303E-7	1687	0.138	0.114	Q9C0Z4.pdb.gz	DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB21F2.02 PE=1 SV=1
16	AFDB:F4I8B3	0.109	0.120	2.760E-7	1203	0.096	0.111	F4I8B3.pdb.gz	F4I8B3_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=HEB1 PE=1 SV=1
17	AFDB:Q584G7	0.116	0.104	3.428E-7	1671	0.136	0.114	Q584G7.pdb.gz	Q584G7_TRYB2 SEC7 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.220 PE=4 SV=1
18	AFDB:Q86VV8	0.137	0.100	3.686E-7	2226	0.144	0.091	Q86VV8.pdb.gz	RTTN_HUMAN Rotatin OS=Homo sapiens OX=9606 GN=RTTN PE=1 SV=3
19	AFDB:Q8L5Y6	0.199	0.222	4.108E-7	1219	0.099	0.114	Q8L5Y6.pdb.gz	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
20	AFDB:Q9FLY5	0.129	0.126	4.259E-7	1443	0.109	0.106	Q9FLY5.pdb.gz	GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana OX=3702 GN=GNL1 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHX4	0.0	1327	2734	0.523	0.268	A0A0B4KHX4_DROME Neurofibromin 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=1
2	A0A0B4KI28	0.0	1328	2793	0.523	0.262	A0A0B4KI28_DROME Neurofibromin 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=1
3	E7FFY1	0.0	2282	2759	0.794	0.403	E7FFY1_DANRE Neurofibromin 1b OS=Danio rerio OX=7955 GN=nf1b PE=1 SV=1
4	O01397	0.0	1324	2802	0.522	0.261	O01397_DROME Neurofibromin OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=1
5	O01398	0.0	1324	2802	0.522	0.261	O01398_DROME Neurofibromin OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=2 SV=1
6	O01399	0.0	1324	2764	0.522	0.264	O01399_DROME Neurofibromin OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=2 SV=1
7	P21359	0.0	2920	2839	1.000	0.493	NF1_HUMAN Neurofibromin OS=Homo sapiens OX=9606 GN=NF1 PE=1 SV=2
8	P97526	0.0	2807	2820	0.962	0.478	NF1_RAT Neurofibromin OS=Rattus norvegicus OX=10116 GN=Nf1 PE=1 SV=1
9	Q04690	0.0	2855	2841	0.976	0.481	NF1_MOUSE Neurofibromin OS=Mus musculus OX=10090 GN=Nf1 PE=1 SV=1
10	Q59DT9	0.0	1327	2764	0.523	0.265	Q59DT9_DROME Neurofibromin 1, isoform D OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=1
11	Q8IMS2	0.0	1327	2746	0.523	0.267	Q8IMS2_DROME Neurofibromin 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=2
12	Q9VBJ2	0.0	1327	2802	0.523	0.261	Q9VBJ2_DROME Neurofibromin 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=3
13	P19158	2.43e-25	117	3079	0.077	0.035	IRA2_YEAST Inhibitory regulator protein IRA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRA2 PE=1 SV=2
14	P18963	3.84e-18	94.0	3092	0.080	0.036	IRA1_YEAST Inhibitory regulator protein IRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRA1 PE=1 SV=2
15	Q55CR5	6.09e-16	86.7	2044	0.044	0.030	Q55CR5_DICDI Regulator of chromosome condensation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269934 PE=4 SV=1
16	A0A1D8PFE8	3.19e-14	80.9	2643	0.094	0.050	A0A1D8PFE8_CANAL Ras GTPase activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IRA2 PE=4 SV=1
17	Q14644	5.02e-12	73.2	834	0.036	0.060	RASA3_HUMAN Ras GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=RASA3 PE=1 SV=3
18	Q54Y08	2.87e-11	70.9	877	0.029	0.047	NGAP_DICDI Probable Ras GTPase-activating-like protein ngap OS=Dictyostelium discoideum OX=44689 GN=ngap PE=2 SV=1
19	E7F916	6.38e-10	66.2	833	0.031	0.052	E7F916_DANRE RAS p21 protein activator 3 OS=Danio rerio OX=7955 GN=rasa3 PE=1 SV=1
20	Q15283	2.55e-09	64.3	850	0.028	0.046	RASA2_HUMAN Ras GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=RASA2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09090 MIF4G_like_2	34	15.3	MIF4G like
2	PF00616 RasGAP	4.2e-11	54.5	GTPase-activator protein for Ras-like GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351015

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407586	0.999	GTPase HRas
2	9606.ENSP00000299084	0.997	Sprouty-related, EVH1 domain-containing protein 1
3	9606.ENSP00000307046	0.996	Syndecan-2
4	9606.ENSP00000256078	0.994	GTPase KRas
5	9606.ENSP00000358548	0.994	GTPase NRas
6	9606.ENSP00000418960	0.970	Breast cancer type 1 susceptibility protein
7	9606.ENSP00000351777	0.968	Transitional endoplasmic reticulum ATPase
8	9606.ENSP00000395654	0.965	Transcription activator BRG1
9	9606.ENSP00000370542	0.962	Syndecan-1
10	9606.ENSP00000246792	0.961	Ras-related protein R-Ras
11	9606.ENSP00000320485	0.959	AT-rich interactive domain-containing protein 1A
12	9606.ENSP00000256196	0.956	Ras-related protein R-Ras2
13	9606.ENSP00000263121	0.950	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
14	9606.ENSP00000264414	0.940	Cullin-3
15	9606.ENSP00000349960	0.940	Actin, cytoplasmic 1
16	9606.ENSP00000480158	0.939	DNA-directed RNA polymerase II subunit RPB1
17	9606.ENSP00000356840	0.937	POU domain, class 2, transcription factor 1
18	9606.ENSP00000231509	0.935	Glucocorticoid receptor
19	9606.ENSP00000309591	0.935	cAMP-dependent protein kinase catalytic subunit alpha
20	9606.ENSP00000339191	0.934	Caveolin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	0.999	GTPase activator activity
GO:0005515	0.998	protein binding
GO:0043167	0.918	ion binding
GO:0031210	0.888	phosphatidylcholine binding
GO:0008429	0.557	phosphatidylethanolamine binding
GO:0097159	0.302	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008283	0.972	cell population proliferation
GO:0060251	0.967	regulation of glial cell proliferation
GO:0048731	0.967	system development
GO:0050790	0.966	regulation of catalytic activity
GO:0007612	0.959	learning
GO:0051716	0.944	cellular response to stimulus
GO:0042063	0.944	gliogenesis
GO:0048523	0.921	negative regulation of cellular process
GO:0048518	0.915	positive regulation of biological process
GO:0007165	0.899	signal transduction
GO:1902531	0.876	regulation of intracellular signal transduction
GO:0050680	0.862	negative regulation of epithelial cell proliferation
GO:0001937	0.840	negative regulation of endothelial cell proliferation
GO:0072359	0.837	circulatory system development
GO:0043087	0.831	regulation of GTPase activity
GO:1901342	0.826	regulation of vasculature development
GO:0070372	0.824	regulation of ERK1 and ERK2 cascade
GO:0045685	0.823	regulation of glial cell differentiation
GO:0051345	0.815	positive regulation of hydrolase activity
GO:0061351	0.811	neural precursor cell proliferation
GO:0043409	0.797	negative regulation of MAPK cascade
GO:0040013	0.791	negative regulation of locomotion
GO:0019222	0.767	regulation of metabolic process
GO:0046578	0.760	regulation of Ras protein signal transduction
GO:0030334	0.754	regulation of cell migration
GO:0060255	0.735	regulation of macromolecule metabolic process
GO:0048522	0.728	positive regulation of cellular process
GO:0010033	0.721	response to organic substance
GO:0080090	0.721	regulation of primary metabolic process
GO:0051171	0.715	regulation of nitrogen compound metabolic process
GO:0046580	0.715	negative regulation of Ras protein signal transduction
GO:0031323	0.714	regulation of cellular metabolic process
GO:0007613	0.708	memory
GO:0048513	0.690	animal organ development
GO:0048468	0.688	cell development
GO:0009719	0.667	response to endogenous stimulus
GO:0022603	0.660	regulation of anatomical structure morphogenesis
GO:0051961	0.660	negative regulation of nervous system development
GO:0051128	0.655	regulation of cellular component organization
GO:0008306	0.629	associative learning
GO:0035556	0.629	intracellular signal transduction
GO:0065008	0.616	regulation of biological quality
GO:0046958	0.616	nonassociative learning
GO:0050679	0.601	positive regulation of epithelial cell proliferation
GO:0007264	0.600	small GTPase mediated signal transduction
GO:2000181	0.578	negative regulation of blood vessel morphogenesis
GO:0070373	0.572	negative regulation of ERK1 and ERK2 cascade
GO:0001938	0.567	positive regulation of endothelial cell proliferation
GO:2000146	0.537	negative regulation of cell motility
GO:0007507	0.536	heart development
GO:0043547	0.535	positive regulation of GTPase activity
GO:0001944	0.533	vasculature development
GO:0045765	0.527	regulation of angiogenesis
GO:0030336	0.525	negative regulation of cell migration
GO:0001568	0.503	blood vessel development
GO:1901700	0.502	response to oxygen-containing compound
GO:0007265	0.433	Ras protein signal transduction
GO:0010594	0.390	regulation of endothelial cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.991	membrane
GO:0005829	0.986	cytosol
GO:0043226	0.979	organelle
GO:0032991	0.901	protein-containing complex
GO:0005634	0.901	nucleus
GO:0042995	0.632	cell projection
GO:0120025	0.590	plasma membrane bounded cell projection
GO:0030054	0.498	cell junction
GO:0043005	0.495	neuron projection
GO:0036477	0.436	somatodendritic compartment
GO:0030424	0.351	axon
GO:0045202	0.343	synapse
GO:0097447	0.306	dendritic tree
GO:0030425	0.300	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]