StarFunc result for job id P21397

User Input

>input (527 residues)
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21396	0.996	0.997	0.000	526	0.871	0.873	P21396.pdb.gz	AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus OX=10116 GN=Maoa PE=1 SV=1
2	AFDB:P21397	1.000	1.000	0.000	527	1.000	1.000	P21397.pdb.gz	AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens OX=9606 GN=MAOA PE=1 SV=1
3	PDB:2z5xA	0.972	0.998	1.944E-102	513	0.973	1.000	2z5xA.pdb.gz	Structure of human monoamine oxidase A at 2.2-A resolution: The control of opening the entry for substrates/inhibitors
4	AFDB:Q6NSN2	0.967	0.976	1.238E-93	522	0.679	0.686	Q6NSN2.pdb.gz	AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio OX=7955 GN=mao PE=1 SV=1
5	AFDB:P58028	0.962	0.975	3.066E-93	520	0.702	0.712	P58028.pdb.gz	AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus OX=10141 GN=MAOB PE=2 SV=2
6	AFDB:P19643	0.975	0.988	3.244E-93	520	0.710	0.719	P19643.pdb.gz	AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus OX=10116 GN=Maob PE=1 SV=3
7	AFDB:P27338	0.973	0.986	9.521E-93	520	0.712	0.721	P27338.pdb.gz	AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens OX=9606 GN=MAOB PE=1 SV=3
8	PDB:1o5wC	0.963	0.992	1.356E-92	512	0.863	0.889	1o5wC.pdb.gz	Structure of rat monoamine oxidase a and its specific recognitions for substrates and inhibitors.
9	PDB:6fvzA	0.943	0.993	7.462E-89	500	0.694	0.732	6fvzA.pdb.gz	Tight-Binding Inhibition of Human Monoamine Oxidase B by Chromone Analogs: A Kinetic, Crystallographic, and Biological Analysis.
10	AFDB:P9WQ15	0.828	0.959	1.638E-52	454	0.302	0.350	P9WQ15.pdb.gz	AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aofH PE=1 SV=1
11	AFDB:H8ZPX1	0.724	0.765	4.885E-32	497	0.188	0.199	H8ZPX1.pdb.gz	PNAO_PSESP Pseudooxynicotine dehydrogenase OS=Pseudomonas sp. OX=306 GN=pao PE=1 SV=1
12	AFDB:Q54HR9	0.714	0.805	3.569E-28	464	0.176	0.200	Q54HR9.pdb.gz	Q54HR9_DICDI Amine oxidase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289265 PE=4 SV=1
13	AFDB:Q8CIG3	0.658	0.432	7.889E-28	826	0.184	0.117	Q8CIG3.pdb.gz	KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus OX=10090 GN=Kdm1b PE=1 SV=1
14	PDB:5ts5A	0.701	0.760	1.768E-27	483	0.186	0.203	5ts5A.pdb.gz	Crystal structure and molecular dynamics studies of L-amino acid oxidase from Bothrops atrox.
15	PDB:7xe1A	0.639	0.460	2.347E-27	751	0.195	0.137	7xe1A.pdb.gz	Structure-Activity Relationship and In Silico Evaluation of cis- and trans-PCPA-Derived Inhibitors of LSD1 and LSD2
16	PDB:3kpfA	0.663	0.738	1.843E-25	467	0.157	0.178	3kpfA.pdb.gz	The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis
17	PDB:5mbxA	0.648	0.717	6.543E-24	472	0.182	0.203	5mbxA.pdb.gz	The Structure of Murine N(1)-Acetylspermine Oxidase Reveals Molecular Details of Vertebrate Polyamine Catabolism.
18	PDB:6tuyA	0.617	0.496	7.217E-22	667	0.192	0.151	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
19	PDB:4gdpB	0.633	0.661	1.095E-20	502	0.184	0.193	4gdpB.pdb.gz	Mechanistic and Structural Analyses of the Roles of Active Site Residues in Yeast Polyamine Oxidase Fms1: Characterization of the N195A and D94N Enzymes.
20	PDB:1rsgA	0.615	0.668	1.159E-20	481	0.171	0.187	1rsgA.pdb.gz	Crystal structures of fms1 and its complex with spermine reveal substrate specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19643	0.0	785	520	0.702	0.712	AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus OX=10116 GN=Maob PE=1 SV=3
2	P21396	0.0	956	526	0.871	0.873	AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus OX=10116 GN=Maoa PE=1 SV=1
3	P21397	0.0	1098	527	1.000	1.000	AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens OX=9606 GN=MAOA PE=1 SV=1
4	P27338	0.0	793	520	0.700	0.710	AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens OX=9606 GN=MAOB PE=1 SV=3
5	P58028	0.0	776	520	0.689	0.698	AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus OX=10141 GN=MAOB PE=2 SV=2
6	Q53YE7	0.0	1098	527	1.000	1.000	Q53YE7_HUMAN Amine oxidase OS=Homo sapiens OX=9606 GN=MAOA PE=2 SV=1
7	Q64133	0.0	980	526	0.873	0.875	AOFA_MOUSE Amine oxidase [flavin-containing] A OS=Mus musculus OX=10090 GN=Maoa PE=1 SV=3
8	Q6NSN2	0.0	776	522	0.679	0.686	AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio OX=7955 GN=mao PE=1 SV=1
9	Q8BW75	0.0	799	520	0.708	0.717	AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus OX=10090 GN=Maob PE=1 SV=4
10	P9WQ15	3.36e-80	259	454	0.311	0.361	AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aofH PE=1 SV=1
11	H8ZPX1	2.08e-21	99.8	497	0.203	0.215	PNAO_PSESP Pseudooxynicotine dehydrogenase OS=Pseudomonas sp. OX=306 GN=pao PE=1 SV=1
12	Q8H191	1.45e-19	94.0	497	0.220	0.233	PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana OX=3702 GN=PAO4 PE=1 SV=1
13	Q7XR46	1.17e-17	88.2	487	0.209	0.226	PAO4_ORYSJ Polyamine oxidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=PAO4 PE=1 SV=1
14	Q7X809	1.26e-17	87.8	484	0.203	0.221	PAO3_ORYSJ Polyamine oxidase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=PAO3 PE=1 SV=2
15	Q96RQ9	1.42e-17	88.2	567	0.224	0.208	OXLA_HUMAN L-amino-acid oxidase OS=Homo sapiens OX=9606 GN=IL4I1 PE=1 SV=1
16	P81383	2.24e-17	87.0	491	0.214	0.230	OXLA_OPHHA L-amino-acid oxidase OS=Ophiophagus hannah OX=8665 PE=1 SV=3
17	Q9LYT1	2.24e-17	87.0	488	0.194	0.209	PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana OX=3702 GN=PAO3 PE=1 SV=1
18	Q9SKX5	2.20e-16	84.0	490	0.194	0.208	PAO2_ARATH Polyamine oxidase 2 OS=Arabidopsis thaliana OX=3702 GN=PAO2 PE=1 SV=1
19	O64411	1.01e-15	82.0	500	0.186	0.196	PAO1_MAIZE Polyamine oxidase 1 OS=Zea mays OX=4577 GN=MPAO1 PE=1 SV=1
20	Q21988	3.76e-15	80.9	824	0.203	0.130	KDM1B_CAEEL Lysine-specific histone demethylase 1B homolog OS=Caenorhabditis elegans OX=6239 GN=amx-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01262 AlaDh_PNT_C	4	18.2	Alanine dehydrogenase/PNT, C-terminal domain
2	PF01593 Amino_oxidase	3.2e-70	249.3	Flavin containing amine oxidoreductase
3	PF01266 DAO	2.2e-05	35.8	FAD dependent oxidoreductase
4	PF00890 FAD_binding_2	0.057	24.1	FAD binding domain
5	PF01494 FAD_binding_3	0.0024	28.8	FAD binding domain
6	PF12831 FAD_oxidored	0.059	24.3	FAD dependent oxidoreductase
7	PF01134 GIDA	23	15.5	Glucose inhibited division protein A
8	PF03486 HI0933_like	0.044	24.1	HI0933-like protein
9	PF05834 Lycopene_cycl	10	16.6	Lycopene cyclase protein
10	PF07687 M20_dimer	2.1e+02	13.3	Peptidase dimerisation domain
11	PF06100 MCRA	4.7e+02	11.0	MCRA family
12	PF13450 NAD_binding_8	7.4e-11	53.4	NAD(P)-binding Rossmann-like domain
13	PF00070 Pyr_redox	0.015	27.1	Pyridine nucleotide-disulphide oxidoreductase
14	PF07992 Pyr_redox_2	0.093	23.6	Pyridine nucleotide-disulphide oxidoreductase
15	PF13738 Pyr_redox_3	0.28	22.0	Pyridine nucleotide-disulphide oxidoreductase
16	PF01946 Thi4	0.14	23.0	Thi4 family
17	PF02254 TrkA_N	5.8e+02	12.1	TrkA-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000022677

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000012926	0.997	Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones.
2	9601.ENSPPYP00000005665	0.996	Is capable of converting retinaldehyde to retinoic acid.
3	9601.ENSPPYP00000023716	0.996	Catalyzes the oxidation of medium and long-chain aliphatic aldehydes to fatty acids. Active on a variety of saturated and unsaturated aliphatic aldehydes between 6 and 24 carbons in length. Responsible for conversion of the sphingosine 1-phosphate (S1P) degradation product hexadecenal to hexadecenoic acid.
4	9601.ENSPPYP00000019680	0.994	Dopa decarboxylase (aromatic L-amino acid decarboxylase)
5	9601.ENSPPYP00000003452	0.989	Aldehyde dehydrogenase 3 family, member B1
6	9601.ENSPPYP00000009919	0.989	Aldehyde dehydrogenase 3 family, member A1
7	9601.ENSPPYP00000016692	0.988	Pongo abelii alcohol dehydrogenase 1A (class I), alpha polypeptide (ADH1A), mRNA
8	9601.ENSPPYP00000021352	0.988	ALDHs play a major role in the detoxification of alcohol- derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation (By similarity)
9	9601.ENSPPYP00000023896	0.988	Aldehyde dehydrogenase 7 family, member A1
10	9601.ENSPPYP00000000664	0.987	Converts gamma-trimethylaminobutyraldehyde into gamma- butyrobetaine with high efficiency (in vitro). Can catalyze the irreversible oxidation of a broad range of aldehydes to the corresponding acids in an NAD-dependent reaction, but with low efficiency
11	9601.ENSPPYP00000016690	0.987	Alcohol dehydrogenase 6
12	9601.ENSPPYP00000016693	0.987	Alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
13	9601.ENSPPYP00000022591	0.987	Spermidine/spermine N1-acetyltransferase 1
14	9601.ENSPPYP00000024488	0.987	Alcohol dehydrogenase 4 (class II), pi polypeptide
15	9601.ENSPPYP00000008920	0.986	Spermidine/spermine N1-acetyltransferase family member 2
16	9601.ENSPPYP00000022139	0.944	Dopamine beta-hydroxylase (dopamine beta-monooxygenase)
17	9601.ENSPPYP00000014313	0.940	Inactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine
18	9601.ENSPPYP00000016688	0.928	Alcohol dehydrogenase 5 (class III), chi polypeptide
19	9601.ENSPPYP00000013271	0.926	Uncharacterized protein
20	9601.ENSPPYP00000009726	0.924	Aralkylamine N-acetyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0008131	0.993	primary amine oxidase activity
GO:0005515	0.989	protein binding
GO:0043167	0.897	ion binding
GO:0050660	0.837	flavin adenine dinucleotide binding
GO:0097621	0.418	monoamine oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0009987	0.989	cellular process
GO:0044237	0.983	cellular metabolic process
GO:0006576	0.944	biogenic amine metabolic process
GO:1901360	0.931	organic cyclic compound metabolic process
GO:0009712	0.924	catechol-containing compound metabolic process
GO:0042417	0.840	dopamine metabolic process
GO:0042402	0.823	cellular biogenic amine catabolic process
GO:1901616	0.690	organic hydroxy compound catabolic process
GO:0044248	0.674	cellular catabolic process
GO:0065007	0.591	biological regulation
GO:0050789	0.476	regulation of biological process
GO:1901361	0.439	organic cyclic compound catabolic process
GO:0019439	0.430	aromatic compound catabolic process
GO:0050794	0.413	regulation of cellular process
GO:0019336	0.394	phenol-containing compound catabolic process
GO:0050896	0.369	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.999	membrane
GO:0005829	0.986	cytosol
GO:0031090	0.882	organelle membrane
GO:0098588	0.707	bounding membrane of organelle
GO:0031975	0.519	envelope
GO:0031967	0.502	organelle envelope
GO:0019867	0.385	outer membrane
GO:0031968	0.382	organelle outer membrane
GO:0005740	0.365	mitochondrial envelope
GO:0005741	0.362	mitochondrial outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.4.3.21	0.993	primary-amine oxidase.
EC:1.4.3.4	0.418	monoamine oxidase.

[back to server]