StarFunc result for job id P21439

User Input

>input (1286 residues)
MDLEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQDKLFMSLG
TIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILEEEMTRYAYYY
SGLGAGVLVAAYIQVSFWTLAAGRQIRKIRQKFFHAILRQEIGWFDINDTTELNTRLTDD
ISKISEGIGDKVGMFFQAVATFFAGFIVGFIRGWKLTLVIMAISPILGLSAAVWAKILSA
FSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANIS
MGIAFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQAAPCIDAFANA
RGAAYVIFDIIDNNPKIDSFSERGHKPDSIKGNLEFNDVHFSYPSRANVKILKGLNLKVQ
SGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINIDGQDIRNFNVNYLREIIGVVSQEPV
LFSTTIAENICYGRGNVTMDEIKKAVKEANAYEFIMKLPQKFDTLVGERGAQLSGGQKQR
IAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVI
AGFEDGVIVEQGSHSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKS
RLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKTEWPYFVVGTVCAIA
NGGLQPAFSVIFSEIIAIFGPGDDAVKQQKCNIFSLIFLFLGIISFFTFFLQGFTFGKAG
EILTRRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNIA
NLGTGIIISFIYGWQLTLLLLAVVPIIAVSGIVEMKLLAGNAKRDKKELEAAGKIATEAI
ENIRTVVSLTQERKFESMYVEKLYGPYRNSVQKAHIYGITFSISQAFMYFSYAGCFRFGA
YLIVNGHMRFRDVILVFSAIVFGAVALGHASSFAPDYAKAKLSAAHLFMLFERQPLIDSY
SEEGLKPDKFEGNITFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQ
LLERFYDPLAGTVFVDFGFQLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAENIAYG
DNSRVVSQDEIVSAAKAANIHPFIETLPHKYETRVGDKGTQLSGGQKQRIAIARALIRQP
QILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEH
GTHQQLLAQKGIYFSMVSVQAGTQNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4m1mA	0.901	0.974	0.000	1188	0.712	0.770	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
2	PDB:6qexA	0.815	0.881	0.000	1182	0.729	0.794	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.
3	PDB:7niwA	0.789	0.882	0.000	1140	0.882	0.995	7niwA.pdb.gz	Structures of ABCB4 provide insight into phosphatidylcholine translocation.
4	AFDB:A0A2R8QDG3	0.919	0.875	0.000	1350	0.549	0.523	A0A2R8QDG3.pdb.gz
5	AFDB:A4D1D2	0.958	0.963	0.000	1280	0.755	0.759	A4D1D2.pdb.gz	A4D1D2_HUMAN ATP-binding cassette, sub-family B (MDR/TAP), member 1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=2 SV=1
6	AFDB:B5X0E4	0.919	0.941	0.000	1255	0.505	0.517	B5X0E4.pdb.gz	ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus OX=10090 GN=Abcb5 PE=2 SV=1
7	AFDB:B8K1W2	0.909	0.882	0.000	1325	0.490	0.475	B8K1W2.pdb.gz	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
8	AFDB:E7EZD3	0.892	0.878	0.000	1308	0.507	0.498	E7EZD3.pdb.gz
9	AFDB:E7F1E3	0.922	0.930	0.000	1275	0.631	0.636	E7F1E3.pdb.gz	E7F1E3_DANRE ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Danio rerio OX=7955 GN=zgc:172149 PE=4 SV=1
10	AFDB:G5EDF9	0.905	0.915	0.000	1272	0.449	0.454	G5EDF9.pdb.gz	G5EDF9_CAEEL ABC transporter PGP-2 OS=Caenorhabditis elegans OX=6239 GN=pgp-2 PE=1 SV=1
11	AFDB:G5EG61	0.820	0.796	0.000	1327	0.369	0.358	G5EG61.pdb.gz	G5EG61_CAEEL p-GlycoProtein related OS=Caenorhabditis elegans OX=6239 GN=pgp-14 PE=1 SV=1
12	AFDB:O70127	0.918	0.894	0.000	1321	0.481	0.469	O70127.pdb.gz	ABCBB_RAT Bile salt export pump OS=Rattus norvegicus OX=10116 GN=Abcb11 PE=1 SV=1
13	AFDB:O80725	0.900	0.900	0.000	1286	0.413	0.413	O80725.pdb.gz	AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1
14	PDB:4f4cA	0.753	0.772	2.014E-102	1250	0.421	0.433	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
15	PDB:6lr0U	0.837	0.873	1.245E-98	1230	0.485	0.507	6lr0U.pdb.gz
16	PDB:7dv5U	0.856	0.923	3.560E-96	1189	0.487	0.526	7dv5U.pdb.gz	Structures of human bile acid exporter ABCB11 reveal a transport mechanism facilitated by two tandem substrate-binding pockets.
17	PDB:7vluA	0.552	0.597	2.152E-50	1159	0.165	0.183	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
18	PDB:7s5xE	0.577	0.535	4.253E-49	1412	0.177	0.161	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
19	PDB:7mpeA	0.680	0.620	4.774E-47	1428	0.181	0.163	7mpeA.pdb.gz
20	PDB:6jb1B	0.639	0.607	3.388E-46	1366	0.166	0.156	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y6F1	1021	721	0.392	0.699	A0A8I5Y6F1_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
2	A0A8I5ZY39	1882	1248	0.723	0.745	A0A8I5ZY39_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
3	A0A8I6GMN6	1889	1243	0.725	0.750	A0A8I6GMN6_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
4	A0MH69	1236	1336	0.511	0.492	A0MH69_ONCMY Bile salt export pump OS=Oncorhynchus mykiss OX=8022 GN=Abcb11 PE=2 SV=2
5	A4D1D2	1984	1280	0.759	0.762	A4D1D2_HUMAN ATP-binding cassette, sub-family B (MDR/TAP), member 1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=2 SV=1
6	B5X0E4	1370	1255	0.507	0.520	ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus OX=10090 GN=Abcb5 PE=2 SV=1
7	B8K1W2	1242	1325	0.495	0.480	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
8	E7F1E3	1689	1275	0.629	0.635	E7F1E3_DANRE ATP-binding cassette, sub-family B (MDR/TAP), member 4 OS=Danio rerio OX=7955 GN=zgc:172149 PE=4 SV=1
9	F1R7A8	1454	1338	0.552	0.531	F1R7A8_DANRE ABC transporter B family member 5 (Fragment) OS=Danio rerio OX=7955 GN=abcb5 PE=1 SV=1
10	F7FKA8	1904	1286	0.729	0.729	F7FKA8_RAT ATP-binding cassette, subfamily B (MDR/TAP), member 1B OS=Rattus norvegicus OX=10116 GN=Abcb1a PE=1 SV=1
11	G5EDF9	1092	1272	0.453	0.458	G5EDF9_CAEEL ABC transporter PGP-2 OS=Caenorhabditis elegans OX=6239 GN=pgp-2 PE=1 SV=1
12	G5EG61	821	1327	0.378	0.366	G5EG61_CAEEL p-GlycoProtein related OS=Caenorhabditis elegans OX=6239 GN=pgp-14 PE=1 SV=1
13	M9PEB5	904	1206	0.383	0.408	M9PEB5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=AMT PE=4 SV=1
14	O70127	1221	1321	0.485	0.472	ABCBB_RAT Bile salt export pump OS=Rattus norvegicus OX=10116 GN=Abcb11 PE=1 SV=1
15	O80725	985	1286	0.414	0.414	AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana OX=3702 GN=ABCB4 PE=1 SV=1
16	O93437	1810	1288	0.703	0.702	O93437_CHICK ABC transporter protein (P-glycoprotein) OS=Gallus gallus OX=9031 GN=cmdr1 PE=2 SV=2
17	O95342	1269	1321	0.504	0.491	ABCBB_HUMAN Bile salt export pump OS=Homo sapiens OX=9606 GN=ABCB11 PE=1 SV=2
18	P06795	1858	1276	0.694	0.699	MDR1B_MOUSE ATP-dependent translocase ABCB1 OS=Mus musculus OX=10090 GN=Abcb1b PE=1 SV=1
19	P08183	1984	1280	0.759	0.762	MDR1_HUMAN ATP-dependent translocase ABCB1 OS=Homo sapiens OX=9606 GN=ABCB1 PE=1 SV=3
20	P21439	2640	1286	1.000	1.000	MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens OX=9606 GN=ABCB4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	0.00054	31.8	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.095	24.1	AAA domain
3	PF13175 AAA_15	0.057	24.6	AAA ATPase domain
4	PF13191 AAA_16	0.0001	34.2	AAA ATPase domain
5	PF13207 AAA_17	2.6e+02	13.4	AAA domain
6	PF13238 AAA_18	12	17.9	AAA domain
7	PF13304 AAA_21	1.9	19.8	AAA domain, putative AbiEii toxin, Type IV TA system
8	PF13401 AAA_22	0.00026	32.7	AAA domain
9	PF13476 AAA_23	5.5e+02	12.5	AAA domain
10	PF13479 AAA_24	2.8	19.1	AAA domain
11	PF13481 AAA_25	56	14.7	AAA domain
12	PF13521 AAA_28	1.5	20.5	AAA domain
13	PF13555 AAA_29	0.019	26.0	P-loop containing region of AAA domain
14	PF13604 AAA_30	0.37	22.0	AAA domain
15	PF13671 AAA_33	40	15.8	AAA domain
16	PF07728 AAA_5	0.1	24.0	AAA domain (dynein-related subfamily)
17	PF12775 AAA_7	0.11	23.5	P-loop containing dynein motor region
18	PF09818 ABC_ATPase	2.9e-08	44.7	ATPase of the ABC class
19	PF00664 ABC_membrane	6.8e-164	555.7	ABC transporter transmembrane region
20	PF00005 ABC_tran	5.6e-70	245.6	ABC transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265723

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385523	0.946	Peroxisome proliferator-activated receptor alpha
2	9606.ENSP00000419692	0.921	Retinoic acid receptor RXR-alpha
3	9606.ENSP00000260129	0.913	Trimethylguanosine synthase
4	9606.ENSP00000217964	0.907	F-box-like/WD repeat-containing protein TBL1X
5	9606.ENSP00000325690	0.907	Histone-arginine methyltransferase CARM1
6	9606.ENSP00000417401	0.905	Helicase with zinc finger domain 2
7	9606.ENSP00000457466	0.905	Chromodomain-helicase-DNA-binding protein 9
8	9606.ENSP00000262367	0.904	CREB-binding protein
9	9606.ENSP00000385216	0.904	Nuclear receptor coactivator 1
10	9606.ENSP00000300651	0.903	Mediator of RNA polymerase II transcription subunit 1
11	9606.ENSP00000405574	0.903	F-box-like/WD repeat-containing protein TBL1XR1
12	9606.ENSP00000262188	0.900	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
13	9606.ENSP00000363929	0.900	Nuclear receptor coactivator 6
14	9606.ENSP00000399968	0.900	Nuclear receptor coactivator 2
15	9606.ENSP00000445359	0.821	Phospholipid-transporting ATPase IC
16	9606.ENSP00000478255	0.811	Multidrug resistance protein 1
17	9606.ENSP00000216540	0.759	Sodium/bile acid cotransporter
18	9606.ENSP00000383232	0.734	Glutathione hydrolase 1 proenzyme
19	9606.ENSP00000447149	0.721	Bile acid receptor
20	9606.ENSP00000295834	0.707	Fatty acid-binding protein, liver

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	0.999	transmembrane transporter activity
GO:0005515	0.997	protein binding
GO:0140657	0.993	ATP-dependent activity
GO:0022804	0.992	active transmembrane transporter activity
GO:0042626	0.977	ATPase-coupled transmembrane transporter activity
GO:0140303	0.888	intramembrane lipid transporter activity
GO:0005548	0.886	phospholipid transporter activity
GO:0140326	0.881	ATPase-coupled intramembrane lipid transporter activity
GO:0140328	0.534	floppase activity
GO:0008525	0.478	phosphatidylcholine transporter activity
GO:0015562	0.429	efflux transmembrane transporter activity
GO:0090554	0.408	phosphatidylcholine floppase activity
GO:0140359	0.405	ABC-type transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.968	response to stimulus
GO:0009987	0.924	cellular process
GO:0042221	0.907	response to chemical
GO:0051179	0.847	localization
GO:0065007	0.790	biological regulation
GO:0006810	0.741	transport
GO:0050789	0.630	regulation of biological process
GO:0050794	0.568	regulation of cellular process
GO:0051716	0.527	cellular response to stimulus
GO:0008152	0.454	metabolic process
GO:0071704	0.405	organic substance metabolic process
GO:0071702	0.389	organic substance transport
GO:0044238	0.306	primary metabolic process
GO:0044237	0.304	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.962	intracellular membrane-bounded organelle
GO:0005737	0.902	cytoplasm
GO:0098590	0.700	plasma membrane region
GO:0045177	0.669	apical part of cell
GO:0016324	0.654	apical plasma membrane
GO:0070013	0.596	intracellular organelle lumen
GO:0012505	0.482	endomembrane system
GO:0031090	0.369	organelle membrane
GO:0031981	0.314	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.977	Translocases.
EC:7.6.2.1	0.881	P-type phospholipid transporter.
RHEA:38583	0.408	a 1,2-diacyl-sn-glycero-3-phosphocholine(out) + ATP + H2O = a 1,2-diacyl-sn-glycero-3-phosphocholine(in) + ADP + H(+) + phosphate

[back to server]