StarFunc result for job id P21453

User Input

>input (382 residues)
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48303	0.920	0.918	2.390E-46	383	0.932	0.930	P48303.pdb.gz	S1PR1_RAT Sphingosine 1-phosphate receptor 1 OS=Rattus norvegicus OX=10116 GN=S1pr1 PE=1 SV=1
2	AFDB:Q9DDK4	0.830	0.875	2.845E-35	362	0.673	0.710	Q9DDK4.pdb.gz	S1PR1_DANRE Sphingosine 1-phosphate receptor 1 OS=Danio rerio OX=7955 GN=s1pr1 PE=2 SV=2
3	PDB:7td3R	0.720	0.933	1.454E-33	292	0.759	0.993	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
4	PDB:3v2yA	0.746	0.629	1.676E-30	455	0.746	0.626	3v2yA.pdb.gz	Crystal structure of a lipid G protein-coupled receptor.
5	AFDB:Q99500	0.781	0.789	4.892E-30	378	0.497	0.503	Q99500.pdb.gz	S1PR3_HUMAN Sphingosine 1-phosphate receptor 3 OS=Homo sapiens OX=9606 GN=S1PR3 PE=1 SV=2
6	AFDB:Q9Z0U9	0.776	0.784	1.168E-29	378	0.479	0.484	Q9Z0U9.pdb.gz	S1PR3_MOUSE Sphingosine 1-phosphate receptor 3 OS=Mus musculus OX=10090 GN=S1pr3 PE=2 SV=1
7	AFDB:O95136	0.780	0.842	5.400E-27	353	0.429	0.465	O95136.pdb.gz	S1PR2_HUMAN Sphingosine 1-phosphate receptor 2 OS=Homo sapiens OX=9606 GN=S1PR2 PE=1 SV=2
8	AFDB:Q9H228	0.773	0.743	6.452E-26	398	0.453	0.435	Q9H228.pdb.gz	S1PR5_HUMAN Sphingosine 1-phosphate receptor 5 OS=Homo sapiens OX=9606 GN=S1PR5 PE=1 SV=1
9	AFDB:Q9I8K8	0.752	0.775	1.088E-25	370	0.440	0.454	Q9I8K8.pdb.gz	S1PR2_DANRE Sphingosine 1-phosphate receptor 2 OS=Danio rerio OX=7955 GN=s1pr2 PE=1 SV=1
10	AFDB:Q91X56	0.768	0.734	4.573E-25	400	0.442	0.422	Q91X56.pdb.gz	S1PR5_MOUSE Sphingosine 1-phosphate receptor 5 OS=Mus musculus OX=10090 GN=S1pr5 PE=1 SV=1
11	PDB:7ew2R	0.695	0.903	5.580E-23	290	0.455	0.600	7ew2R.pdb.gz	Structural insights into sphingosine-1-phosphate recognition and ligand selectivity of S1PR3-Gi signaling complexes.
12	AFDB:Q6NYH8	0.752	0.650	1.009E-22	445	0.401	0.344	Q6NYH8.pdb.gz
13	AFDB:P61793	0.760	0.797	2.628E-22	364	0.338	0.354	P61793.pdb.gz	LPAR1_MOUSE Lysophosphatidic acid receptor 1 OS=Mus musculus OX=10090 GN=Lpar1 PE=1 SV=1
14	PDB:7t6bR	0.633	0.900	5.217E-18	264	0.398	0.576	7t6bR.pdb.gz	Structure of S1PR2-heterotrimeric G 13 signaling complex.
15	PDB:7td1R	0.650	0.839	8.420E-18	293	0.296	0.386	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
16	PDB:7yu4A	0.638	0.904	2.974E-17	266	0.293	0.421	7yu4A.pdb.gz	Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.
17	PDB:7wv9R	0.627	0.809	1.872E-13	290	0.225	0.297	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
18	PDB:6pt0R	0.648	0.818	5.827E-12	298	0.202	0.258	6pt0R.pdb.gz	Cryo-EM Structure of the Human Cannabinoid Receptor CB2-GiSignaling Complex.
19	PDB:7e32R	0.593	0.775	8.656E-11	285	0.212	0.284	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
20	PDB:7f53R	0.582	0.797	2.355E-10	273	0.204	0.286	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08530	0.0	729	382	0.942	0.942	S1PR1_MOUSE Sphingosine 1-phosphate receptor 1 OS=Mus musculus OX=10090 GN=S1pr1 PE=1 SV=3
2	P21453	0.0	774	382	1.000	1.000	S1PR1_HUMAN Sphingosine 1-phosphate receptor 1 OS=Homo sapiens OX=9606 GN=S1PR1 PE=1 SV=2
3	P48303	0.0	724	383	0.932	0.930	S1PR1_RAT Sphingosine 1-phosphate receptor 1 OS=Rattus norvegicus OX=10116 GN=S1pr1 PE=1 SV=1
4	Q9DDK4	0.0	519	362	0.675	0.713	S1PR1_DANRE Sphingosine 1-phosphate receptor 1 OS=Danio rerio OX=7955 GN=s1pr1 PE=2 SV=2
5	A0A3B3IUD4	3.44e-126	362	178	0.466	1.000	A0A3B3IUD4_HUMAN Sphingosine-1-phosphate receptor 1 (Fragment) OS=Homo sapiens OX=9606 GN=S1PR1 PE=1 SV=1
6	Q99500	5.57e-125	367	378	0.466	0.471	S1PR3_HUMAN Sphingosine 1-phosphate receptor 3 OS=Homo sapiens OX=9606 GN=S1PR3 PE=1 SV=2
7	Q9Z0U9	4.69e-123	362	378	0.453	0.458	S1PR3_MOUSE Sphingosine 1-phosphate receptor 3 OS=Mus musculus OX=10090 GN=S1pr3 PE=2 SV=1
8	O95136	3.19e-110	328	353	0.424	0.459	S1PR2_HUMAN Sphingosine 1-phosphate receptor 2 OS=Homo sapiens OX=9606 GN=S1PR2 PE=1 SV=2
9	P52592	4.98e-110	328	352	0.429	0.466	S1PR2_MOUSE Sphingosine 1-phosphate receptor 2 OS=Mus musculus OX=10090 GN=S1pr2 PE=1 SV=3
10	Q9I8K8	3.93e-109	326	370	0.453	0.468	S1PR2_DANRE Sphingosine 1-phosphate receptor 2 OS=Danio rerio OX=7955 GN=s1pr2 PE=1 SV=1
11	P47752	5.16e-109	325	352	0.429	0.466	S1PR2_RAT Sphingosine 1-phosphate receptor 2 OS=Rattus norvegicus OX=10116 GN=S1pr2 PE=1 SV=1
12	Q9H228	4.64e-101	306	398	0.461	0.442	S1PR5_HUMAN Sphingosine 1-phosphate receptor 5 OS=Homo sapiens OX=9606 GN=S1PR5 PE=1 SV=1
13	Q9JKM5	2.47e-92	284	400	0.435	0.415	S1PR5_RAT Sphingosine 1-phosphate receptor 5 OS=Rattus norvegicus OX=10116 GN=S1pr5 PE=1 SV=1
14	Q91X56	6.46e-92	283	400	0.435	0.415	S1PR5_MOUSE Sphingosine 1-phosphate receptor 5 OS=Mus musculus OX=10090 GN=S1pr5 PE=1 SV=1
15	F1QC10	7.62e-90	277	389	0.377	0.370	F1QC10_DANRE Sphingosine 1-phosphate receptor 4 OS=Danio rerio OX=7955 GN=edg6 PE=3 SV=1
16	Q9Z0L1	1.60e-72	233	386	0.338	0.334	S1PR4_MOUSE Sphingosine 1-phosphate receptor 4 OS=Mus musculus OX=10090 GN=S1pr4 PE=2 SV=1
17	Q92633	4.51e-71	228	364	0.322	0.338	LPAR1_HUMAN Lysophosphatidic acid receptor 1 OS=Homo sapiens OX=9606 GN=LPAR1 PE=1 SV=3
18	Q6DHQ8	6.27e-71	227	346	0.312	0.344	Q6DHQ8_DANRE Lysophosphatidic acid receptor 1 OS=Danio rerio OX=7955 GN=edg2 PE=2 SV=1
19	P61793	1.15e-70	227	364	0.322	0.338	LPAR1_MOUSE Lysophosphatidic acid receptor 1 OS=Mus musculus OX=10090 GN=Lpar1 PE=1 SV=1
20	P61794	1.15e-70	227	364	0.322	0.338	LPAR1_RAT Lysophosphatidic acid receptor 1 OS=Rattus norvegicus OX=10116 GN=Lpar1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.2e-38	144.5	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	14	17.0	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	0.0077	27.2	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF05439 JTB	1e+02	14.4	Jumping translocation breakpoint protein (JTB)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305416

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228434	0.988	Early activation antigen CD69
2	9606.ENSP00000261799	0.974	Platelet-derived growth factor receptor beta
3	9606.ENSP00000451828	0.964	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000264657	0.963	Signal transducer and activator of transcription 3
5	9606.ENSP00000264832	0.950	Intercellular adhesion molecule 1
6	9606.ENSP00000343027	0.946	Guanine nucleotide-binding protein G(i) subunit alpha-1
7	9606.ENSP00000358867	0.944	Guanine nucleotide-binding protein G(k) subunit alpha
8	9606.ENSP00000262494	0.939	Guanine nucleotide-binding protein G(o) subunit alpha
9	9606.ENSP00000362680	0.938	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000263025	0.937	Mitogen-activated protein kinase 3
11	9606.ENSP00000400175	0.934	Transforming protein RhoA
12	9606.ENSP00000337825	0.926	Tyrosine-protein kinase Lck
13	9606.ENSP00000357470	0.924	Interleukin-6 receptor subunit alpha
14	9606.ENSP00000346671	0.923	Tyrosine-protein kinase Fyn
15	9606.ENSP00000312999	0.921	Guanine nucleotide-binding protein G(i) subunit alpha-2
16	9606.ENSP00000330382	0.921	Platelet-derived growth factor subunit B
17	9606.ENSP00000348461	0.918	Ras-related C3 botulinum toxin substrate 1
18	9606.ENSP00000313681	0.916	Sphingosine kinase 1
19	9606.ENSP00000321345	0.915	Interleukin-23 receptor
20	9606.ENSP00000428924	0.915	Tyrosine-protein kinase Lyn

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005488	0.998	binding
GO:0005515	0.985	protein binding
GO:0005102	0.528	signaling receptor binding
GO:0008528	0.326	G protein-coupled peptide receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.997	signal transduction
GO:0007186	0.982	G protein-coupled receptor signaling pathway
GO:0048518	0.789	positive regulation of biological process
GO:0048522	0.733	positive regulation of cellular process
GO:0032501	0.460	multicellular organismal process
GO:0019222	0.432	regulation of metabolic process
GO:0048583	0.400	regulation of response to stimulus
GO:0048519	0.394	negative regulation of biological process
GO:0042221	0.369	response to chemical
GO:0060255	0.350	regulation of macromolecule metabolic process
GO:0031323	0.344	regulation of cellular metabolic process
GO:0051239	0.343	regulation of multicellular organismal process
GO:0080090	0.334	regulation of primary metabolic process
GO:0051171	0.316	regulation of nitrogen compound metabolic process
GO:0009893	0.312	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.964	intracellular anatomical structure
GO:0043226	0.963	organelle
GO:0043227	0.939	membrane-bounded organelle
GO:0043231	0.890	intracellular membrane-bounded organelle
GO:0005737	0.724	cytoplasm
GO:0005634	0.711	nucleus
GO:0070013	0.696	intracellular organelle lumen
GO:0031981	0.487	nuclear lumen
GO:0005654	0.445	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]