StarFunc result for job id P21506

User Input

>input (573 residues)
MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKP
DVILRLEKGEEPWLVEREIHQETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMARND
LWYLSLEEVWKCRDQLDKYQENPERHLRQVAFTQKKVLTQERVSESGKYGGNCLLPAQLV
LREYFHKRDSHTKSLKHDLVLNGHQDSCASNSNECGQTFCQNIHLIQFARTHTGDKSYKC
PDNDNSLTHGSSLGISKGIHREKPYECKECGKFFSWRSNLTRHQLIHTGEKPYECKECGK
SFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYTCNQCGKSFVH
SSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHL
VVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGKSFSQSSALIVHQ
RIHTGEKPYECCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHT
GEQFLTCNQCGTALVNTSNLIGYQTNHIRENAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21506	1.000	1.000	2.135E-94	573	1.000	1.000	P21506.pdb.gz	ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens OX=9606 GN=ZNF10 PE=1 SV=3
2	AFDB:A0A024R4S7	0.475	0.352	1.879E-50	792	0.464	0.336	A0A024R4S7.pdb.gz
3	AFDB:Q9UJW8	0.339	0.285	1.126E-47	692	0.504	0.418	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
4	AFDB:Q14587	0.453	0.284	1.336E-47	947	0.436	0.264	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
5	AFDB:Q16587	0.425	0.384	2.504E-47	644	0.401	0.357	Q16587.pdb.gz	ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens OX=9606 GN=ZNF74 PE=1 SV=3
6	AFDB:A0A0A0MS50	0.501	0.477	7.410E-47	604	0.438	0.416	A0A0A0MS50.pdb.gz	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
7	AFDB:Q9Y473	0.477	0.394	5.468E-46	711	0.417	0.336	Q9Y473.pdb.gz	ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens OX=9606 GN=ZNF175 PE=1 SV=1
8	AFDB:Q6NX49	0.440	0.362	8.974E-45	715	0.421	0.337	Q6NX49.pdb.gz	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
9	AFDB:Q96MU6	0.404	0.328	5.907E-44	729	0.400	0.314	Q96MU6.pdb.gz	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
10	AFDB:Q5MCW4	0.427	0.361	7.011E-44	686	0.415	0.347	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
11	PDB:3w5kB	0.087	0.278	2.042E-4	110	0.065	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.054	0.232	3.229E-1	96	0.030	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:4kblA	0.052	0.067	4.296E-1	395	0.061	0.089	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
14	PDB:6ydhA	0.031	0.168	5.099E-1	62	0.031	0.290	6ydhA.pdb.gz
15	PDB:7cunA	0.083	0.070	6.784E-1	730	0.051	0.040	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
16	PDB:7o4i1	0.077	0.081	1.271	522	0.089	0.098	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
17	PDB:5n5yI	0.027	0.118	1.346	99	0.024	0.141	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
18	PDB:5gm6a	0.036	0.124	2.125	123	0.040	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:6hlqI	0.038	0.112	2.125	111	0.049	0.252	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
20	PDB:7ena4	0.076	0.087	2.125	457	0.045	0.057	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21506	0.0	1191	573	1.000	1.000	ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens OX=9606 GN=ZNF10 PE=1 SV=3
2	Q9UJW8	0.0	533	692	0.536	0.444	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
3	A0A0A0MS50	5.96e-170	497	604	0.469	0.445	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
4	Q96RE9	8.61e-170	497	604	0.469	0.445	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
5	P52742	1.10e-168	496	658	0.485	0.422	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
6	Q9P2J8	8.98e-162	485	865	0.443	0.294	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
7	Q8WXB4	1.09e-158	474	792	0.455	0.330	ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens OX=9606 GN=ZNF606 PE=2 SV=1
8	Q5MCW4	1.64e-158	471	686	0.466	0.389	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
9	Q6ECI4	3.06e-158	471	717	0.449	0.358	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
10	Q8TF47	4.72e-157	465	636	0.452	0.407	ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens OX=9606 GN=ZFP90 PE=1 SV=2
11	Q8NA42	2.92e-155	455	475	0.428	0.516	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
12	Q9BX82	1.58e-153	456	626	0.442	0.404	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
13	Q8N184	2.22e-151	451	647	0.476	0.422	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
14	P51814	2.20e-149	452	821	0.447	0.312	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
15	Q4V8A8	6.70e-149	444	633	0.443	0.401	ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus OX=10116 GN=Zfp90 PE=2 SV=1
16	Q14587	6.75e-149	454	947	0.457	0.277	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
17	Q8TAQ5	7.38e-149	446	688	0.443	0.369	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
18	Q6ZN57	1.63e-147	434	461	0.394	0.490	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
19	A6NNF4	4.77e-147	439	616	0.428	0.398	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
20	P17014	2.57e-146	440	697	0.461	0.379	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10892 DUF2688	6.8e+02	11.1	Protein of unknown function (DUF2688)
2	PF07754 HVO_2753_ZBP	8.9	17.5	Small zinc finger protein HVO_2753-like, Zn-binding pocket
3	PF01352 KRAB	4.4e-19	79.1	KRAB box
4	PF00096 zf-C2H2	8.7e-59	204.0	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	3e-28	107.0	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	2.7e-07	41.6	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	41	15.9	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	1.3e-67	232.7	Zinc-finger double domain
9	PF13451 zf-trcl	1.1e+02	14.1	Probable zinc-ribbon domain
10	PF18439 zf_UBZ	0.046	24.7	Ubiquitin-Binding Zinc Finger
11	PF17032 zinc_ribbon_15	7.6	18.7	zinc-ribbon family
12	PF09723 Zn-ribbon_8	2.4e-08	45.3	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253024	0.953	Transcription intermediary factor 1-beta
2	9606.ENSP00000263956	0.752	General transcription factor 3C polypeptide 3
3	9606.ENSP00000359837	0.738	ZZ-type zinc finger-containing protein 3
4	9606.ENSP00000340507	0.692	Transcription intermediary factor 1-alpha
5	9606.ENSP00000451188	0.637	GSK3B-interacting protein
6	9606.ENSP00000353010	0.621	Autophagy-related protein 2 homolog B
7	9606.ENSP00000351250	0.556	E3 ubiquitin-protein ligase TRIM33

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.470	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.995	regulation of gene expression
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0031324	0.905	negative regulation of cellular metabolic process
GO:0051172	0.899	negative regulation of nitrogen compound metabolic process
GO:0010605	0.891	negative regulation of macromolecule metabolic process
GO:0045892	0.877	negative regulation of DNA-templated transcription
GO:0009987	0.454	cellular process
GO:0048518	0.423	positive regulation of biological process
GO:0048522	0.402	positive regulation of cellular process
GO:0006357	0.325	regulation of transcription by RNA polymerase II
GO:0009893	0.308	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0032991	0.989	protein-containing complex
GO:0005654	0.976	nucleoplasm
GO:0043232	0.715	intracellular non-membrane-bounded organelle
GO:0005730	0.358	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]