StarFunc result for job id P21579

User Input

>input (422 residues)
MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWA
LIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALK
DDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDP
YVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI
IGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL
KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVV
TVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV
KK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21579	1.000	1.000	1.114E-71	422	1.000	1.000	P21579.pdb.gz	SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE=1 SV=1
2	AFDB:P29101	0.675	0.675	5.693E-59	422	0.763	0.763	P29101.pdb.gz	SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus OX=10116 GN=Syt2 PE=1 SV=1
3	AFDB:P41823	0.345	0.340	5.354E-50	428	0.573	0.565	P41823.pdb.gz	SY65_APLCA Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2
4	AFDB:P21521	0.603	0.546	1.116E-49	474	0.583	0.519	P21521.pdb.gz	SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3
5	AFDB:Q95QH7	0.504	0.484	1.471E-46	443	0.524	0.499	Q95QH7.pdb.gz	Q95QH7_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=1 SV=1
6	AFDB:O00445	0.363	0.396	1.199E-45	386	0.536	0.585	O00445.pdb.gz	SYT5_HUMAN Synaptotagmin-5 OS=Homo sapiens OX=9606 GN=SYT5 PE=1 SV=2
7	AFDB:Q965S5	0.341	0.500	1.674E-41	284	0.403	0.599	Q965S5.pdb.gz	Q965S5_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snt-3 PE=1 SV=4
8	AFDB:O43581	0.342	0.357	5.084E-39	403	0.374	0.392	O43581.pdb.gz	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
9	AFDB:O08625	0.412	0.346	1.698E-38	523	0.358	0.289	O08625.pdb.gz	SYT10_RAT Synaptotagmin-10 OS=Rattus norvegicus OX=10116 GN=Syt10 PE=2 SV=2
10	AFDB:Q62746	0.425	0.367	3.930E-38	511	0.374	0.309	Q62746.pdb.gz	SYT6_RAT Synaptotagmin-6 OS=Rattus norvegicus OX=10116 GN=Syt6 PE=1 SV=1
11	PDB:3pfqA	0.284	0.231	5.585E-11	523	0.109	0.088	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6kxkD	0.179	0.139	5.351E-9	553	0.123	0.094	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
13	PDB:5iz5B	0.220	0.126	1.610E-8	746	0.088	0.050	5iz5B.pdb.gz
14	PDB:5ixcA	0.215	0.135	2.879E-7	684	0.088	0.054	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5A	0.201	0.115	4.616E-7	757	0.083	0.046	5iz5A.pdb.gz
16	PDB:5izrC	0.210	0.137	2.112E-6	659	0.088	0.056	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5a50A	0.196	0.480	1.633E-5	165	0.090	0.230	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:4rj9A	0.186	0.470	2.357E-5	161	0.076	0.199	4rj9A.pdb.gz
19	PDB:5a52A	0.186	0.489	4.912E-5	154	0.076	0.208	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
20	PDB:3nsjA	0.177	0.142	8.299E-5	530	0.055	0.043	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A075F932	0.0	683	421	0.955	0.957	SYT1_ANSCY Synaptotagmin-1 OS=Anser cygnoides OX=8845 GN=SYT1 PE=2 SV=1
2	P21579	0.0	867	422	1.000	1.000	SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE=1 SV=1
3	P21707	0.0	845	421	0.979	0.981	SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus OX=10116 GN=Syt1 PE=1 SV=3
4	P29101	0.0	566	422	0.751	0.751	SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus OX=10116 GN=Syt2 PE=1 SV=1
5	P46096	0.0	842	421	0.976	0.979	SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1
6	P46097	0.0	567	422	0.756	0.756	SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus OX=10090 GN=Syt2 PE=1 SV=1
7	P48018	0.0	864	422	0.998	0.998	SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus OX=9913 GN=SYT1 PE=1 SV=1
8	Q8N9I0	0.0	565	419	0.749	0.754	SYT2_HUMAN Synaptotagmin-2 OS=Homo sapiens OX=9606 GN=SYT2 PE=1 SV=2
9	P21521	7.49e-161	463	474	0.564	0.502	SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3
10	P41823	4.78e-159	457	428	0.595	0.586	SY65_APLCA Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2
11	O00445	3.71e-157	450	386	0.538	0.588	SYT5_HUMAN Synaptotagmin-5 OS=Homo sapiens OX=9606 GN=SYT5 PE=1 SV=2
12	P47861	5.88e-156	447	386	0.521	0.570	SYT5_RAT Synaptotagmin-5 OS=Rattus norvegicus OX=10116 GN=Syt5 PE=1 SV=1
13	Q9R0N5	2.99e-152	438	386	0.521	0.570	SYT5_MOUSE Synaptotagmin-5 OS=Mus musculus OX=10090 GN=Syt5 PE=1 SV=1
14	P34693	4.44e-144	419	441	0.564	0.540	SYT1_CAEEL Synaptotagmin-1 OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=2 SV=1
15	Q95QH7	1.28e-131	387	443	0.528	0.503	Q95QH7_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=1 SV=1
16	Q965S5	6.54e-116	342	284	0.400	0.595	Q965S5_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snt-3 PE=1 SV=4
17	K8FE10	8.96e-98	298	369	0.334	0.382	SYT2_CAEEL Synaptotagmin 2 OS=Caenorhabditis elegans OX=6239 GN=snt-2 PE=1 SV=1
18	O43581	8.68e-97	297	403	0.367	0.385	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
19	Q86SS6	5.64e-94	293	491	0.327	0.281	SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE=1 SV=1
20	Q9R0N7	2.48e-92	286	403	0.370	0.387	SYT7_MOUSE Synaptotagmin-7 OS=Mus musculus OX=10090 GN=Syt7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.9e-52	186.6	C2 domain
2	PF15627 CEP76-C2	36	15.4	CEP76 C2 domain
3	PF15957 Comm	3.9	19.2	Commissureless
4	PF06869 DUF1258	2.3e+02	12.6	Protein of unknown function (DUF1258)
5	PF12273 RCR	6.1e+02	12.5	Chitin synthesis regulation, resistance to Congo red
6	PF13908 Shisa	49	15.5	Wnt and FGF inhibitory regulator
7	PF00927 Transglut_C	1.1e+02	14.3	Transglutaminase family, C-terminal ig like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006086

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017581	0.998	Synaptosomal-associated protein, 25kDa
2	61853.ENSNLEP00000010811	0.989	Uncharacterized protein
3	61853.ENSNLEP00000020882	0.981	Chromogranin A (parathyroid secretory protein 1)
4	61853.ENSNLEP00000016932	0.980	Chromogranin B (secretogranin 1)
5	61853.ENSNLEP00000011985	0.977	Vesicle-associated membrane protein 2 (synaptobrevin 2)
6	61853.ENSNLEP00000012675	0.972	S100 calcium binding protein A13
7	61853.ENSNLEP00000020474	0.937	Adapter protein involved in endocytic machinery. Involved in the synaptic vesicle recycling. May facilitate clathrin-coated vesicle uncoating
8	61853.ENSNLEP00000011873	0.928	Multifunctional fusion protein
9	61853.ENSNLEP00000019507	0.892	Syntaxin 1B
10	61853.ENSNLEP00000004486	0.867	Vesicle-associated membrane protein 1 (synaptobrevin 1)
11	61853.ENSNLEP00000007190	0.853	RAB3A, member RAS oncogene family
12	61853.ENSNLEP00000010693	0.849	May be involved in the endocytic machinery.
13	61853.ENSNLEP00000021199	0.839	Syntaxin binding protein 1
14	61853.ENSNLEP00000005475	0.830	Unc-13 homolog B (C. elegans)
15	61853.ENSNLEP00000010687	0.821	Vesicle-associated membrane protein 3
16	61853.ENSNLEP00000014844	0.818	Synaptotagmin XI
17	61853.ENSNLEP00000003543	0.808	Presenilin
18	61853.ENSNLEP00000007791	0.802	Solute carrier family 32 (GABA vesicular transporter), member 1
19	61853.ENSNLEP00000006254	0.792	Solute carrier family 17 (vesicular glutamate transporter), member 7
20	61853.ENSNLEP00000003126	0.780	RAB3C, member RAS oncogene family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000149	0.999	SNARE binding
GO:0005544	0.999	calcium-dependent phospholipid binding
GO:0005509	0.999	calcium ion binding
GO:0019905	0.985	syntaxin binding
GO:0005102	0.926	signaling receptor binding
GO:0070325	0.571	lipoprotein particle receptor binding
GO:0050750	0.442	low-density lipoprotein particle receptor binding
GO:0017075	0.408	syntaxin-1 binding
GO:0048306	0.375	calcium-dependent protein binding
GO:0042802	0.335	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0032879	0.970	regulation of localization
GO:0045055	0.969	regulated exocytosis
GO:0099003	0.939	vesicle-mediated transport in synapse
GO:0060627	0.931	regulation of vesicle-mediated transport
GO:0007269	0.931	neurotransmitter secretion
GO:0017156	0.930	calcium-ion regulated exocytosis
GO:0051046	0.906	regulation of secretion
GO:1903305	0.854	regulation of regulated secretory pathway
GO:0048522	0.847	positive regulation of cellular process
GO:0051128	0.834	regulation of cellular component organization
GO:0099504	0.833	synaptic vesicle cycle
GO:0099177	0.832	regulation of trans-synaptic signaling
GO:0051952	0.772	regulation of amine transport
GO:0031338	0.766	regulation of vesicle fusion
GO:0045921	0.758	positive regulation of exocytosis
GO:1903307	0.754	positive regulation of regulated secretory pathway
GO:0050896	0.749	response to stimulus
GO:0014059	0.726	regulation of dopamine secretion
GO:0016079	0.689	synaptic vesicle exocytosis
GO:0032501	0.568	multicellular organismal process
GO:0051130	0.554	positive regulation of cellular component organization
GO:0010638	0.537	positive regulation of organelle organization
GO:0050804	0.479	modulation of chemical synaptic transmission
GO:0017158	0.427	regulation of calcium ion-dependent exocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0012505	1.000	endomembrane system
GO:0031410	1.000	cytoplasmic vesicle
GO:0030054	0.997	cell junction
GO:0031090	0.997	organelle membrane
GO:0098588	0.993	bounding membrane of organelle
GO:0030659	0.993	cytoplasmic vesicle membrane
GO:0045202	0.992	synapse
GO:0099503	0.986	secretory vesicle
GO:0030672	0.975	synaptic vesicle membrane
GO:0005886	0.971	plasma membrane
GO:0030135	0.778	coated vesicle
GO:0030136	0.737	clathrin-coated vesicle
GO:0120025	0.545	plasma membrane bounded cell projection
GO:0043005	0.507	neuron projection
GO:0030424	0.354	axon
GO:0030141	0.352	secretory granule
GO:0030139	0.345	endocytic vesicle
GO:0030665	0.318	clathrin-coated vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]