StarFunc result for job id P21580

User Input

>input (790 residues)
MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTP
MARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
EQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK
LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRS
PGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCF
KRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGD
RTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGR
ECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARAS
CKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCN
ECFQFKQMYG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21580	1.000	1.000	0.000	790	1.000	1.000	P21580.pdb.gz	TNAP3_HUMAN Tumor necrosis factor alpha-induced protein 3 OS=Homo sapiens OX=9606 GN=TNFAIP3 PE=1 SV=1
2	AFDB:Q60769	0.663	0.675	0.000	775	0.881	0.898	Q60769.pdb.gz	TNAP3_MOUSE Tumor necrosis factor alpha-induced protein 3 OS=Mus musculus OX=10090 GN=Tnfaip3 PE=1 SV=2
3	AFDB:A0A2R8QN12	0.513	0.552	1.793E-86	730	0.484	0.523	A0A2R8QN12.pdb.gz
4	AFDB:F1QG48	0.474	0.495	1.611E-85	756	0.486	0.508	F1QG48.pdb.gz
5	PDB:4ddgA	0.106	0.188	9.889E-4	399	0.054	0.108	4ddgA.pdb.gz
6	PDB:4dhjA	0.112	0.302	8.885E-3	248	0.041	0.129	4dhjA.pdb.gz
7	PDB:4fjvA	0.108	0.299	1.257E-2	231	0.047	0.160	4fjvA.pdb.gz	The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
8	AFDB:Q8STF6	0.058	0.053	2.072E-1	887	0.092	0.082	Q8STF6.pdb.gz	DYC1_CAEEL Dystrophin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=dyc-1 PE=1 SV=1
9	AFDB:Q6XBN7	0.055	0.072	2.931E-1	535	0.082	0.121	Q6XBN7.pdb.gz	Q6XBN7_CHICK Disabled-1 early isoform OS=Gallus gallus OX=9031 GN=Dab1 PE=2 SV=1
10	AFDB:A0A024R036	0.043	0.044	3.486E-1	770	0.075	0.077	A0A024R036.pdb.gz
11	AFDB:J3KRL7	0.050	0.033	4.653E-1	1267	0.113	0.070	J3KRL7.pdb.gz	J3KRL7_HUMAN Period circadian regulator 1 OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=1
12	AFDB:Q2NKX8	0.050	0.036	4.930E-1	1250	0.109	0.069	Q2NKX8.pdb.gz	ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1
13	AFDB:A0A2R8Q6Q8	0.049	0.038	5.534E-1	1064	0.081	0.060	A0A2R8Q6Q8.pdb.gz
14	PDB:6zfzA	0.054	0.077	8.530E-1	446	0.030	0.054	6zfzA.pdb.gz	From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease.
15	PDB:4b2tQ	0.053	0.073	9.037E-1	481	0.038	0.062	4b2tQ.pdb.gz
16	PDB:1khiA	0.052	0.161	1.014	147	0.020	0.109	1khiA.pdb.gz
17	PDB:4yrvA	0.055	0.115	1.139	288	0.027	0.073	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
18	PDB:6v7wE	0.039	0.106	1.139	234	0.020	0.068	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
19	PDB:7pikC	0.044	0.055	1.206	557	0.035	0.050	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.
20	PDB:2dytA	0.051	0.132	1.435	213	0.011	0.042	2dytA.pdb.gz	The crystal structure of Atg3, an autophagy-related ubiquitin carrier protein (E2) enzyme that mediates Atg8 lipidation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21580	0.0	1658	790	1.000	1.000	TNAP3_HUMAN Tumor necrosis factor alpha-induced protein 3 OS=Homo sapiens OX=9606 GN=TNFAIP3 PE=1 SV=1
2	Q60769	0.0	1462	775	0.881	0.898	TNAP3_MOUSE Tumor necrosis factor alpha-induced protein 3 OS=Mus musculus OX=10090 GN=Tnfaip3 PE=1 SV=2
3	B2RUR8	3.76e-52	197	840	0.133	0.125	OTU7B_MOUSE OTU domain-containing protein 7B OS=Mus musculus OX=10090 GN=Otud7b PE=1 SV=1
4	Q6GQQ9	6.40e-52	197	843	0.133	0.125	OTU7B_HUMAN OTU domain-containing protein 7B OS=Homo sapiens OX=9606 GN=OTUD7B PE=1 SV=1
5	A0JMB7	1.30e-51	196	917	0.133	0.115	A0JMB7_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=zgc:152772 PE=2 SV=1
6	Q8TE49	2.83e-42	168	926	0.127	0.108	OTU7A_HUMAN OTU domain-containing protein 7A OS=Homo sapiens OX=9606 GN=OTUD7A PE=1 SV=1
7	Q9UGI0	2.09e-33	139	708	0.125	0.140	ZRAN1_HUMAN Ubiquitin thioesterase ZRANB1 OS=Homo sapiens OX=9606 GN=ZRANB1 PE=1 SV=2
8	A0JMQ9	7.24e-32	135	716	0.116	0.128	ZRN1B_DANRE Ubiquitin thioesterase zranb1-B OS=Danio rerio OX=7955 GN=zranb1b PE=2 SV=1
9	Q9VH90	4.10e-28	123	778	0.105	0.107	TRBID_DROME Ubiquitin thioesterase trabid OS=Drosophila melanogaster OX=7227 GN=trbd PE=1 SV=1
10	Q8CDG3	3.74e-09	62.8	1220	0.072	0.047	VCIP1_MOUSE Deubiquitinating protein VCPIP1 OS=Mus musculus OX=10090 GN=Vcpip1 PE=1 SV=1
11	Q8CF97	4.21e-09	62.8	1221	0.072	0.047	VCIP1_RAT Deubiquitinating protein VCPIP1 OS=Rattus norvegicus OX=10116 GN=Vcpip1 PE=1 SV=2
12	Q96JH7	4.25e-09	62.8	1222	0.072	0.047	VCIP1_HUMAN Deubiquitinating protein VCPIP1 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2
13	Q9W0H9	4.77e-04	46.2	696	0.032	0.036	Q9W0H9_DROME Rabaptin-5-associated exchange factor for Rab5 OS=Drosophila melanogaster OX=7227 GN=Rabex-5 PE=1 SV=1
14	Q9DCH6	0.33	36.2	223	0.018	0.063	ZFAN6_MOUSE AN1-type zinc finger protein 6 OS=Mus musculus OX=10090 GN=Zfand6 PE=1 SV=1
15	Q6FIF0	0.37	35.8	208	0.018	0.067	ZFAN6_HUMAN AN1-type zinc finger protein 6 OS=Homo sapiens OX=9606 GN=ZFAND6 PE=1 SV=2
16	O76080	2.5	33.1	213	0.018	0.066	ZFAN5_HUMAN AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1
17	E7F8Q6	2.6	33.9	968	0.019	0.015	E7F8Q6_DANRE Angiomotin OS=Danio rerio OX=7955 GN=amot PE=3 SV=3
18	O88878	3.2	33.1	213	0.018	0.066	ZFAN5_MOUSE AN1-type zinc finger protein 5 OS=Mus musculus OX=10090 GN=Zfand5 PE=1 SV=1
19	A8WIP9	3.6	33.5	834	0.032	0.030	A8WIP9_DANRE DNA-binding protein SATB OS=Danio rerio OX=7955 GN=si:ch211-223c6.1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02338 OTU	3e-30	116.7	OTU-like cysteine protease
2	PF01754 zf-A20	1.2e-34	129.1	A20-like zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.999	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000317891	0.999	TNFAIP3-interacting protein 1
3	9606.ENSP00000441543	0.998	Polyubiquitin-C
4	9606.ENSP00000398698	0.996	Tumor necrosis factor
5	9606.ENSP00000483825	0.995	NF-kappa-B essential modulator
6	9606.ENSP00000259808	0.994	Receptor-interacting serine/threonine-protein kinase 1
7	9606.ENSP00000272317	0.993	Ubiquitin-40S ribosomal protein S27a
8	9606.ENSP00000321203	0.993	TNFAIP3-interacting protein 2
9	9606.ENSP00000379612	0.993	Tax1-binding protein 1
10	9606.ENSP00000433623	0.993	TNF receptor-associated factor 6
11	9606.ENSP00000362994	0.992	TNF receptor-associated factor 1
12	9606.ENSP00000247668	0.988	TNF receptor-associated factor 2
13	9606.ENSP00000430684	0.984	Inhibitor of nuclear factor kappa-B kinase subunit beta
14	9606.ENSP00000304697	0.982	Polyubiquitin-B
15	9606.ENSP00000315112	0.979	E3 ubiquitin-protein ligase RNF31
16	9606.ENSP00000388107	0.979	Ubiquitin-60S ribosomal protein L40
17	9606.ENSP00000301838	0.976	FAS-associated death domain protein
18	9606.ENSP00000348632	0.966	RanBP-type and C3HC4-type zinc finger-containing protein 1
19	9606.ENSP00000381698	0.962	Sharpin
20	9606.ENSP00000300589	0.961	Nucleotide-binding oligomerization domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0004843	0.999	cysteine-type deubiquitinase activity
GO:0042802	0.991	identical protein binding
GO:0016740	0.983	transferase activity
GO:0061578	0.944	K63-linked deubiquitinase activity
GO:0043621	0.942	protein self-association
GO:0043130	0.938	ubiquitin binding
GO:0002020	0.935	protease binding
GO:0004842	0.934	ubiquitin-protein transferase activity
GO:0019900	0.346	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0009966	0.991	regulation of signal transduction
GO:0031323	0.990	regulation of cellular metabolic process
GO:0010468	0.990	regulation of gene expression
GO:0032101	0.986	regulation of response to external stimulus
GO:0080134	0.985	regulation of response to stress
GO:0050896	0.983	response to stimulus
GO:0048518	0.978	positive regulation of biological process
GO:1902531	0.978	regulation of intracellular signal transduction
GO:0002682	0.975	regulation of immune system process
GO:0001817	0.975	regulation of cytokine production
GO:0065009	0.973	regulation of molecular function
GO:0050776	0.973	regulation of immune response
GO:0031347	0.973	regulation of defense response
GO:0051716	0.972	cellular response to stimulus
GO:0048585	0.970	negative regulation of response to stimulus
GO:0048523	0.969	negative regulation of cellular process
GO:0080090	0.965	regulation of primary metabolic process
GO:0002831	0.964	regulation of response to biotic stimulus
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0009968	0.950	negative regulation of signal transduction
GO:0071704	0.947	organic substance metabolic process
GO:0010604	0.945	positive regulation of macromolecule metabolic process
GO:0043122	0.945	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051172	0.930	negative regulation of nitrogen compound metabolic process
GO:0070646	0.929	protein modification by small protein removal
GO:0045088	0.924	regulation of innate immune response
GO:0002376	0.923	immune system process
GO:0031399	0.908	regulation of protein modification process
GO:0010605	0.901	negative regulation of macromolecule metabolic process
GO:0051173	0.890	positive regulation of nitrogen compound metabolic process
GO:0044419	0.886	biological process involved in interspecies interaction between organisms
GO:0051707	0.880	response to other organism
GO:0070887	0.877	cellular response to chemical stimulus
GO:0010033	0.871	response to organic substance
GO:0048522	0.869	positive regulation of cellular process
GO:0001818	0.867	negative regulation of cytokine production
GO:0044092	0.858	negative regulation of molecular function
GO:0051247	0.829	positive regulation of protein metabolic process
GO:0016579	0.809	protein deubiquitination
GO:0010941	0.802	regulation of cell death
GO:1902532	0.737	negative regulation of intracellular signal transduction
GO:0023052	0.736	signaling
GO:0007154	0.736	cell communication
GO:0007165	0.733	signal transduction
GO:0048584	0.683	positive regulation of response to stimulus
GO:0051248	0.654	negative regulation of protein metabolic process
GO:0019219	0.630	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.549	regulation of biosynthetic process
GO:0002832	0.518	negative regulation of response to biotic stimulus
GO:0051090	0.516	regulation of DNA-binding transcription factor activity
GO:0002684	0.514	positive regulation of immune system process
GO:0050778	0.475	positive regulation of immune response
GO:0006950	0.462	response to stress
GO:0032501	0.461	multicellular organismal process
GO:0071310	0.448	cellular response to organic substance
GO:0032103	0.440	positive regulation of response to external stimulus
GO:0032502	0.405	developmental process
GO:0060548	0.405	negative regulation of cell death
GO:0031325	0.404	positive regulation of cellular metabolic process
GO:0002683	0.397	negative regulation of immune system process
GO:0009617	0.397	response to bacterium
GO:0043067	0.395	regulation of programmed cell death
GO:0042127	0.393	regulation of cell population proliferation
GO:0048856	0.390	anatomical structure development
GO:0042981	0.386	regulation of apoptotic process
GO:0009967	0.380	positive regulation of signal transduction
GO:1901701	0.357	cellular response to oxygen-containing compound
GO:0032102	0.346	negative regulation of response to external stimulus
GO:0031400	0.346	negative regulation of protein modification process
GO:0032651	0.345	regulation of interleukin-1 beta production
GO:0043124	0.343	negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0031348	0.338	negative regulation of defense response
GO:0002237	0.331	response to molecule of bacterial origin
GO:0006952	0.321	defense response
GO:0050688	0.315	regulation of defense response to virus
GO:0044237	0.312	cellular metabolic process
GO:0007166	0.311	cell surface receptor signaling pathway
GO:0009894	0.308	regulation of catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.970	cytosol
GO:0043227	0.967	membrane-bounded organelle
GO:0005634	0.959	nucleus
GO:0005576	0.947	extracellular region
GO:0031982	0.877	vesicle
GO:0005615	0.839	extracellular space
GO:0070062	0.719	extracellular exosome
GO:0012505	0.396	endomembrane system
GO:0031981	0.300	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.999	ubiquitinyl hydrolase 1.
EC:2.-.-.-	0.983	Transferases.

[back to server]