StarFunc result for job id P21583

User Input

>input (273 residues)
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEEDNEISMLQEKEREFQEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21583	1.000	1.000	5.419E-44	273	1.000	1.000	P21583.pdb.gz	SCF_HUMAN Kit ligand OS=Homo sapiens OX=9606 GN=KITLG PE=1 SV=1
2	AFDB:P20826	0.690	0.690	1.611E-34	273	0.828	0.828	P20826.pdb.gz	SCF_MOUSE Kit ligand OS=Mus musculus OX=10090 GN=Kitlg PE=1 SV=1
3	AFDB:Q56JH6	0.367	0.368	1.924E-8	272	0.231	0.232	Q56JH6.pdb.gz	Q56JH6_DANRE Kit ligand OS=Danio rerio OX=7955 GN=kitla PE=2 SV=1
4	AFDB:A0A0B5JQ49	0.394	0.250	2.246E-4	482	0.132	0.075	A0A0B5JQ49.pdb.gz
5	AFDB:D8UWE0	0.351	0.355	1.588E-3	270	0.158	0.159	D8UWE0.pdb.gz	D8UWE0_CHICK Colony-stimulating factor 1 OS=Gallus gallus OX=9031 GN=CSF1 PE=2 SV=1
6	AFDB:P09603	0.322	0.179	3.641E-3	554	0.139	0.069	P09603.pdb.gz	CSF1_HUMAN Macrophage colony-stimulating factor 1 OS=Homo sapiens OX=9606 GN=CSF1 PE=1 SV=2
7	AFDB:Q6ZMJ4	0.295	0.325	3.641E-3	242	0.106	0.120	Q6ZMJ4.pdb.gz	IL34_HUMAN Interleukin-34 OS=Homo sapiens OX=9606 GN=IL34 PE=1 SV=1
8	AFDB:A0A0B5JQ32	0.369	0.452	4.616E-3	212	0.070	0.090	A0A0B5JQ32.pdb.gz
9	PDB:1buyA	0.340	0.514	1.046E-2	166	0.088	0.145	1buyA.pdb.gz
10	AFDB:O74509	0.144	0.120	3.264E-2	341	0.139	0.111	O74509.pdb.gz	VAM7_SCHPO Vacuolar morphogenesis protein 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC594.06c PE=3 SV=1
11	AFDB:Q03322	0.177	0.208	1.068E-1	224	0.095	0.116	Q03322.pdb.gz	TLG1_YEAST t-SNARE affecting a late Golgi compartment protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TLG1 PE=1 SV=1
12	PDB:2gmfA	0.236	0.441	1.507E-1	121	0.048	0.107	2gmfA.pdb.gz
13	PDB:1itlA	0.281	0.477	5.889E-1	130	0.055	0.115	1itlA.pdb.gz
14	PDB:5m0iC	0.156	0.174	1.130	240	0.070	0.079	5m0iC.pdb.gz	Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
15	PDB:7d5cA	0.118	0.046	1.273	919	0.088	0.026	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
16	PDB:2jynA	0.104	0.156	1.350	146	0.040	0.075	2jynA.pdb.gz
17	PDB:7c4jI	0.132	0.079	1.433	524	0.070	0.036	7c4jI.pdb.gz
18	PDB:3og6A	0.225	0.339	2.045	143	0.055	0.105	3og6A.pdb.gz
19	PDB:7vrcC	0.120	0.242	2.045	109	0.055	0.138	7vrcC.pdb.gz
20	PDB:6ks7h	0.140	0.085	2.170	480	0.048	0.027	6ks7h.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21583	0.0	557	273	1.000	1.000	SCF_HUMAN Kit ligand OS=Homo sapiens OX=9606 GN=KITLG PE=1 SV=1
2	P21581	4.76e-158	442	273	0.824	0.824	SCF_RAT Kit ligand OS=Rattus norvegicus OX=10116 GN=Kitlg PE=1 SV=2
3	P20826	1.70e-152	428	273	0.828	0.828	SCF_MOUSE Kit ligand OS=Mus musculus OX=10090 GN=Kitlg PE=1 SV=1
4	Q56JH6	1.91e-12	67.8	272	0.150	0.151	Q56JH6_DANRE Kit ligand OS=Danio rerio OX=7955 GN=kitla PE=2 SV=1
5	Q56JH5	1.49e-05	47.8	267	0.136	0.139	Q56JH5_DANRE Kit ligand OS=Danio rerio OX=7955 GN=kitlb PE=2 SV=1
6	C0H496	0.31	35.0	1716	0.125	0.020	C0H496_PLAF7 Reticulocyte binding protein homologue 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0424200 PE=4 SV=1
7	Q9HB75	1.9	32.3	910	0.073	0.022	PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PIDD1 PE=1 SV=2
8	Q6Q4D0	3.0	32.0	1311	0.066	0.014	TONS_ARATH Protein TONSOKU OS=Arabidopsis thaliana OX=3702 GN=TSK PE=1 SV=2
9	Q6ZMN7	3.3	31.6	1036	0.077	0.020	PZRN4_HUMAN PDZ domain-containing RING finger protein 4 OS=Homo sapiens OX=9606 GN=PDZRN4 PE=1 SV=3
10	Q9SDW9	3.3	31.6	461	0.136	0.080	BSS_BOTBR Squalene synthase BSS OS=Botryococcus braunii OX=38881 GN=BSS PE=1 SV=1
11	Q7TMA5	3.5	32.0	4743	0.084	0.005	APOB_RAT Apolipoprotein B-100 OS=Rattus norvegicus OX=10116 GN=Apob PE=1 SV=1
12	C0L3D6	5.2	30.8	535	0.066	0.034	C0L3D6_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=alk6b PE=2 SV=1
13	Q9M1C7	5.4	31.2	1506	0.055	0.010	AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana OX=3702 GN=ABCC9 PE=2 SV=2
14	F4KHD8	8.8	30.4	1923	0.059	0.008	GP210_ARATH Nuclear pore complex protein GP210 OS=Arabidopsis thaliana OX=3702 GN=GB210 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14610 Psg1	54	15.0	Ykl077w/Psg1 (Pma1 Stabilization in Golgi)
2	PF02404 SCF	2.4e-141	481.5	Stem cell factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006667

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010174	0.999	KIT proto-oncogene receptor tyrosine kinase
2	61853.ENSNLEP00000010082	0.934	Platelet-derived growth factor receptor alpha
3	61853.ENSNLEP00000000457	0.927	Fms-related tyrosine kinase 3
4	61853.ENSNLEP00000012499	0.915	Platelet-derived growth factor receptor beta
5	61853.ENSNLEP00000015604	0.910	Neurotrophic tyrosine kinase, receptor, type 1
6	61853.ENSNLEP00000014508	0.877	Erythropoietin
7	61853.ENSNLEP00000010298	0.864	Kinase insert domain receptor (a type III receptor tyrosine kinase)
8	61853.ENSNLEP00000012479	0.864	Colony stimulating factor 1 receptor
9	61853.ENSNLEP00000010419	0.863	Receptor protein-tyrosine kinase
10	61853.ENSNLEP00000019785	0.849	TEK tyrosine kinase, endothelial
11	61853.ENSNLEP00000000655	0.829	Fms-related tyrosine kinase 1
12	61853.ENSNLEP00000003032	0.814	Fms-related tyrosine kinase 4
13	61853.ENSNLEP00000014960	0.813	Fibroblast growth factor receptor 1
14	61853.ENSNLEP00000018867	0.812	Chymase 1, mast cell
15	61853.ENSNLEP00000000072	0.793	Uncharacterized protein
16	61853.ENSNLEP00000015352	0.790	Fibroblast growth factor receptor 4
17	61853.ENSNLEP00000020533	0.789	Fibroblast growth factor receptor 2
18	61853.ENSNLEP00000015215	0.771	Erythropoietin receptor
19	61853.ENSNLEP00000003499	0.767	Megakaryocyte-associated tyrosine kinase
20	61853.ENSNLEP00000004512	0.750	Neurotrophic tyrosine kinase, receptor, type 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005173	1.000	stem cell factor receptor binding
GO:0098772	0.456	molecular function regulator activity
GO:0140677	0.422	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0009987	0.984	cellular process
GO:0032501	0.981	multicellular organismal process
GO:0048522	0.976	positive regulation of cellular process
GO:0008284	0.962	positive regulation of cell population proliferation
GO:0032502	0.957	developmental process
GO:0048856	0.941	anatomical structure development
GO:0007275	0.910	multicellular organism development
GO:0030154	0.888	cell differentiation
GO:0050793	0.881	regulation of developmental process
GO:0048731	0.857	system development
GO:0051716	0.856	cellular response to stimulus
GO:0030097	0.828	hemopoiesis
GO:0048513	0.820	animal organ development
GO:0051094	0.806	positive regulation of developmental process
GO:0007154	0.796	cell communication
GO:0023052	0.795	signaling
GO:0000003	0.792	reproduction
GO:0045595	0.789	regulation of cell differentiation
GO:0007165	0.788	signal transduction
GO:0061458	0.746	reproductive system development
GO:0022414	0.742	reproductive process
GO:0003006	0.704	developmental process involved in reproduction
GO:0019222	0.665	regulation of metabolic process
GO:1901532	0.661	regulation of hematopoietic progenitor cell differentiation
GO:0060255	0.637	regulation of macromolecule metabolic process
GO:0031323	0.580	regulation of cellular metabolic process
GO:0080090	0.578	regulation of primary metabolic process
GO:0048583	0.576	regulation of response to stimulus
GO:0051171	0.568	regulation of nitrogen compound metabolic process
GO:0042221	0.550	response to chemical
GO:0009893	0.520	positive regulation of metabolic process
GO:0048519	0.518	negative regulation of biological process
GO:0051239	0.468	regulation of multicellular organismal process
GO:0007548	0.433	sex differentiation
GO:0048523	0.428	negative regulation of cellular process
GO:0010604	0.426	positive regulation of macromolecule metabolic process
GO:0071704	0.425	organic substance metabolic process
GO:0051173	0.409	positive regulation of nitrogen compound metabolic process
GO:0007166	0.407	cell surface receptor signaling pathway
GO:0048584	0.405	positive regulation of response to stimulus
GO:0009966	0.403	regulation of signal transduction
GO:0044238	0.398	primary metabolic process
GO:0031325	0.396	positive regulation of cellular metabolic process
GO:0051246	0.392	regulation of protein metabolic process
GO:0044237	0.384	cellular metabolic process
GO:0001934	0.384	positive regulation of protein phosphorylation
GO:0048608	0.377	reproductive structure development
GO:0006807	0.376	nitrogen compound metabolic process
GO:0045597	0.371	positive regulation of cell differentiation
GO:0045137	0.368	development of primary sexual characteristics
GO:0043170	0.328	macromolecule metabolic process
GO:0070887	0.328	cellular response to chemical stimulus
GO:0009967	0.325	positive regulation of signal transduction
GO:0065009	0.311	regulation of molecular function
GO:0051240	0.311	positive regulation of multicellular organismal process
GO:0010033	0.309	response to organic substance
GO:0030334	0.307	regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005886	0.999	plasma membrane
GO:0005622	0.944	intracellular anatomical structure
GO:0005615	0.941	extracellular space
GO:0005737	0.926	cytoplasm
GO:0043226	0.818	organelle
GO:0043227	0.812	membrane-bounded organelle
GO:0043231	0.793	intracellular membrane-bounded organelle
GO:0042995	0.536	cell projection
GO:0120025	0.532	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]