StarFunc result for job id P21589

User Input

>input (574 residues)
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG
VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEF
DNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKE
TPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVV
GGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNV
ISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNM
GNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCR
VPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYP
AVEGRIKFSTGSHCHGSFSLIFLSLWAVIFVLYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7jv8C	0.902	0.979	0.000	529	0.908	0.985	7jv8C.pdb.gz	Orally Bioavailable Small-Molecule CD73 Inhibitor (OP-5244) Reverses Immunosuppression through Blockade of Adenosine Production.
2	AFDB:P21588	0.954	0.951	0.000	576	0.876	0.873	P21588.pdb.gz	5NTD_RAT 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5e PE=1 SV=1
3	AFDB:P21589	1.000	1.000	0.000	574	1.000	1.000	P21589.pdb.gz	5NTD_HUMAN 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5E PE=1 SV=1
4	AFDB:Q05927	0.959	0.959	0.000	574	0.897	0.897	Q05927.pdb.gz	5NTD_BOVIN 5'-nucleotidase OS=Bos taurus OX=9913 GN=NT5E PE=1 SV=2
5	AFDB:Q5PNP4	0.921	0.926	5.780E-98	571	0.624	0.627	Q5PNP4.pdb.gz
6	AFDB:Q8SZY4	0.878	0.862	2.401E-72	585	0.390	0.383	Q8SZY4.pdb.gz	Q8SZY4_DROME Ecto-5'-nucleotidase 2, isoform A OS=Drosophila melanogaster OX=7227 GN=NT5E-2 PE=1 SV=1
7	AFDB:Q7K0L5	0.878	0.842	8.836E-69	599	0.392	0.376	Q7K0L5.pdb.gz	Q7K0L5_DROME LP01562p OS=Drosophila melanogaster OX=7227 GN=veil PE=1 SV=1
8	AFDB:Q9VZ32	0.866	0.890	2.880E-63	558	0.312	0.321	Q9VZ32.pdb.gz	Q9VZ32_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG1961 PE=1 SV=3
9	AFDB:Q5B0J1	0.822	0.811	1.331E-57	582	0.294	0.290	Q5B0J1.pdb.gz	Q5B0J1_EMENI 5'-nucleotidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05939 PE=3 SV=1
10	PDB:1ho5A	0.692	0.751	8.814E-42	525	0.240	0.263	1ho5A.pdb.gz	Mechanism of hydrolysis of phosphate esters by the dimetal center of 5'-nucleotidase based on crystal structures.
11	AFDB:P07024	0.720	0.749	1.357E-41	550	0.249	0.260	P07024.pdb.gz	USHA_ECOLI Protein UshA OS=Escherichia coli (strain K12) OX=83333 GN=ushA PE=1 SV=2
12	AFDB:A4VWL5	0.584	0.507	5.294E-38	676	0.225	0.191	A4VWL5.pdb.gz
13	PDB:4b2oA	0.313	0.626	1.785E-8	264	0.068	0.148	4b2oA.pdb.gz	The Ymdb Phosphodiesterase is a Global Regulator of Late Adaptive Responses in Bacillus Subtilis.
14	PDB:5ebeA	0.296	0.383	3.388E-8	418	0.070	0.096	5ebeA.pdb.gz	The structure and catalytic mechanism of human sphingomyelin phosphodiesterase like 3a - an acid sphingomyelinase homologue with a novel nucleotide hydrolase activity.
15	PDB:5fc1A	0.287	0.363	1.453E-7	426	0.073	0.099	5fc1A.pdb.gz	Structural Basis for Nucleotide Hydrolysis by the Acid Sphingomyelinase-like Phosphodiesterase SMPDL3A.
16	PDB:5jg8B	0.276	0.293	7.862E-7	530	0.080	0.087	5jg8B.pdb.gz	Structure of Human Acid Sphingomyelinase Reveals the Role of the Saposin Domain in Activating Substrate Hydrolysis.
17	PDB:5fibA	0.285	0.303	1.182E-6	534	0.085	0.092	5fibA.pdb.gz	Crystal structure of mammalian acid sphingomyelinase.
18	PDB:3ib7A	0.263	0.445	1.883E-6	295	0.087	0.169	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
19	PDB:3av0A	0.264	0.378	2.243E-6	369	0.068	0.106	3av0A.pdb.gz	Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
20	PDB:2bq8X	0.251	0.420	1.532E-5	304	0.064	0.122	2bq8X.pdb.gz	Crystal Structures of Recombinant Human Purple Acid Phosphatase with and without an Inhibitory Conformation of the Repression Loop.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21588	0.0	995	576	0.869	0.866	5NTD_RAT 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5e PE=1 SV=1
2	P21589	0.0	1189	574	1.000	1.000	5NTD_HUMAN 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5E PE=1 SV=1
3	Q05927	0.0	1059	574	0.899	0.899	5NTD_BOVIN 5'-nucleotidase OS=Bos taurus OX=9913 GN=NT5E PE=1 SV=2
4	Q61503	0.0	1014	576	0.868	0.865	5NTD_MOUSE 5'-nucleotidase OS=Mus musculus OX=10090 GN=Nt5e PE=1 SV=2
5	Q7SXU4	0.0	759	571	0.634	0.637	Q7SXU4_DANRE 5'-nucleotidase OS=Danio rerio OX=7955 GN=zgc:63784 PE=2 SV=1
6	Q96B60	0.0	518	264	0.439	0.955	Q96B60_HUMAN 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5E PE=1 SV=1
7	Q8SZY4	9.94e-133	401	585	0.378	0.371	Q8SZY4_DROME Ecto-5'-nucleotidase 2, isoform A OS=Drosophila melanogaster OX=7227 GN=NT5E-2 PE=1 SV=1
8	Q7K0L5	5.64e-129	392	599	0.382	0.366	Q7K0L5_DROME LP01562p OS=Drosophila melanogaster OX=7227 GN=veil PE=1 SV=1
9	Q9VZ32	2.21e-94	301	558	0.307	0.315	Q9VZ32_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG1961 PE=1 SV=3
10	Q5B0J1	6.43e-83	272	582	0.293	0.289	Q5B0J1_EMENI 5'-nucleotidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05939 PE=3 SV=1
11	P07024	1.12e-27	119	550	0.240	0.251	USHA_ECOLI Protein UshA OS=Escherichia coli (strain K12) OX=83333 GN=ushA PE=1 SV=2
12	P08331	1.05e-07	57.4	647	0.134	0.119	CPDB_ECOLI 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) OX=83333 GN=cpdB PE=1 SV=2
13	O13781	0.085	38.1	635	0.057	0.052	YEO3_SCHPO Uncharacterized protein C17G6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G6.03 PE=3 SV=1
14	Q9FJI2	0.38	34.7	166	0.070	0.241	MTHD_ARATH 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTHD PE=1 SV=1
15	P38887	0.48	35.8	602	0.049	0.047	YH02_YEAST Uncharacterized protein YHR202W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHR202W PE=1 SV=1
16	Q03081	1.1	33.5	177	0.030	0.096	MET31_YEAST Transcriptional regulator MET31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET31 PE=1 SV=1
17	P0CC11	7.3	28.1	20	0.019	0.550	BENG_DECBE Bengalin (Fragment) OS=Deccanometrus bengalensis OX=696368 PE=1 SV=1
18	O61775	9.1	31.6	785	0.033	0.024	O61775_CAEEL Very Early Transcript OS=Caenorhabditis elegans OX=6239 GN=vet-2 PE=1 SV=6

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02872 5_nucleotid_C	1e-40	151.0	5'-nucleotidase, C-terminal domain
2	PF00149 Metallophos	1.5e-08	46.9	Calcineurin-like phosphoesterase
3	PF09587 PGA_cap	3e+02	12.2	Bacterial capsule synthesis protein PGA_cap

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360250	0.995	Ectonucleoside triphosphate diphosphohydrolase 1
2	9606.ENSP00000361965	0.973	Adenosine deaminase
3	9606.ENSP00000286621	0.968	Adenosine kinase
4	9606.ENSP00000379038	0.945	Thymidine phosphorylase
5	9606.ENSP00000315644	0.940	Thymidylate synthase
6	9606.ENSP00000354532	0.940	Purine nucleoside phosphorylase
7	9606.ENSP00000232607	0.937	Uridine 5'-monophosphate synthase
8	9606.ENSP00000364212	0.937	Cytidine deaminase
9	9606.ENSP00000370376	0.936	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
10	9606.ENSP00000349576	0.934	Deoxycytidylate deaminase
11	9606.ENSP00000321584	0.931	Inosine-5'-monophosphate dehydrogenase 2
12	9606.ENSP00000259727	0.930	GMP reductase 1
13	9606.ENSP00000345096	0.928	Inosine-5'-monophosphate dehydrogenase 1
14	9606.ENSP00000286648	0.927	Deoxycytidine kinase
15	9606.ENSP00000336630	0.927	Adenosine A2a receptor
16	9606.ENSP00000362299	0.926	Endoglin
17	9606.ENSP00000230792	0.925	Peroxisomal NADH pyrophosphatase NUDT12
18	9606.ENSP00000362481	0.924	Uracil phosphoribosyltransferase homolog
19	9606.ENSP00000369456	0.924	Inosine triphosphate pyrophosphatase
20	9606.ENSP00000222553	0.923	Nicotinamide phosphoribosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008253	1.000	5'-nucleotidase activity
GO:0042802	0.993	identical protein binding
GO:0043167	0.980	ion binding
GO:0046872	0.965	metal ion binding
GO:0046914	0.958	transition metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044238	0.989	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0006793	0.987	phosphorus metabolic process
GO:1901360	0.986	organic cyclic compound metabolic process
GO:1901135	0.985	carbohydrate derivative metabolic process
GO:0046483	0.985	heterocycle metabolic process
GO:0006725	0.985	cellular aromatic compound metabolic process
GO:0006139	0.975	nucleobase-containing compound metabolic process
GO:0055086	0.969	nucleobase-containing small molecule metabolic process
GO:0006753	0.950	nucleoside phosphate metabolic process
GO:0050896	0.946	response to stimulus
GO:0072521	0.944	purine-containing compound metabolic process
GO:0009117	0.908	nucleotide metabolic process
GO:0006163	0.888	purine nucleotide metabolic process
GO:0009259	0.816	ribonucleotide metabolic process
GO:0065007	0.780	biological regulation
GO:0050789	0.773	regulation of biological process
GO:0009150	0.649	purine ribonucleotide metabolic process
GO:0042221	0.638	response to chemical
GO:0050794	0.421	regulation of cellular process
GO:0048518	0.352	positive regulation of biological process
GO:0032501	0.318	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0009986	0.987	cell surface
GO:0005622	0.949	intracellular anatomical structure
GO:0043226	0.946	organelle
GO:0043227	0.897	membrane-bounded organelle
GO:0005737	0.896	cytoplasm
GO:0070013	0.879	intracellular organelle lumen
GO:0005576	0.854	extracellular region
GO:0043231	0.838	intracellular membrane-bounded organelle
GO:0005634	0.822	nucleus
GO:0005829	0.776	cytosol
GO:0005615	0.625	extracellular space
GO:0031981	0.610	nuclear lumen
GO:0031982	0.592	vesicle
GO:0005654	0.591	nucleoplasm
GO:0043230	0.511	extracellular organelle
GO:0065010	0.480	extracellular membrane-bounded organelle
GO:0070062	0.432	extracellular exosome
GO:0012505	0.392	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12484	1.000	a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate
EC:3.1.3.5	1.000	5'-nucleotidase.

[back to server]