StarFunc result for job id P21675

User Input

>input (1872 residues)
MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDD
ECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDE
SRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGEKV
DFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLR
FLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPP
PPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGS
GFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADENFLMVTQLHWEDDIIWDGED
VKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRW
EDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRI
LLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQ
PFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGG
EMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYG
ETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIF
VVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSES
SIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKD
AGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCG
EGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKL
SRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSST
EVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAA
SGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTT
KDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDL
KLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEG
TKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTD
PMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYP
SREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLD
DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKH
KYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICT
AKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSAT
PEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSA
IQLSESGSDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISY
GSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFH
SIAGDSDLDSDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21675	0.999	0.999	0.000	1872	1.000	1.000	P21675.pdb.gz	TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens OX=9606 GN=TAF1 PE=1 SV=3
2	PDB:7eghA	0.253	0.721	9.456E-84	630	0.334	0.992	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
3	PDB:7egbA	0.226	0.735	2.168E-74	558	0.297	0.996	7egbA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
4	PDB:6mzlA	0.214	0.848	2.565E-66	472	0.215	0.854	6mzlA.pdb.gz
5	AFDB:P91621	0.047	0.045	7.122E-7	2072	0.115	0.104	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
6	AFDB:P91620	0.049	0.047	8.351E-6	2061	0.137	0.125	P91620.pdb.gz	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
7	AFDB:Q9UIF8	0.059	0.055	1.962E-5	2168	0.120	0.103	Q9UIF8.pdb.gz	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
8	AFDB:Q9VQM0	0.029	0.027	2.652E-5	2162	0.127	0.110	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
9	AFDB:Q8I398	0.049	0.047	3.083E-5	2112	0.105	0.093	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
10	AFDB:A2AUY4	0.048	0.044	6.230E-5	2123	0.135	0.119	A2AUY4.pdb.gz	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
11	AFDB:Q8BI84	0.045	0.047	6.230E-5	1930	0.138	0.134	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
12	AFDB:Q91YE5	0.042	0.042	1.259E-4	1889	0.121	0.120	Q91YE5.pdb.gz	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
13	AFDB:Q80XI3	0.044	0.049	1.392E-4	1579	0.109	0.129	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
14	PDB:5svag	0.035	0.322	1.683E-3	172	0.011	0.122	5svag.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
15	PDB:5fywR	0.034	0.283	3.075E-3	199	0.012	0.111	5fywR.pdb.gz	Transcription Initiation Complex Structures Elucidate DNA Opening
16	PDB:6gylQ	0.036	0.362	5.960E-2	148	0.007	0.095	6gylQ.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
17	PDB:5okcB	0.032	0.128	9.367E-2	377	0.019	0.093	5okcB.pdb.gz	Structural Basis for the Recruitment of Ctf18-RFC to the Replisome.
18	PDB:6s1cB	0.032	0.124	1.145E-1	342	0.022	0.120	6s1cB.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
19	PDB:6o9lT	0.029	0.212	1.548E-1	237	0.016	0.127	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
20	PDB:7okxO	0.035	0.457	5.716E-1	106	0.008	0.142	7okxO.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A7M0	0.0	3729	1893	0.963	0.952	A0A8I6A7M0_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
2	A0A8I6A7N8	0.0	3642	1837	0.939	0.957	A0A8I6A7N8_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
3	G5EGM3	0.0	813	1744	0.264	0.283	TAF1_CAEEL Transcription initiation factor TFIID subunit 1 OS=Caenorhabditis elegans OX=6239 GN=taf-1 PE=2 SV=1
4	P21675	0.0	3885	1872	1.000	1.000	TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens OX=9606 GN=TAF1 PE=1 SV=3
5	P51123	0.0	1620	2129	0.476	0.419	TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster OX=7227 GN=Taf1 PE=1 SV=3
6	Q1LYC2	0.0	2605	1947	0.735	0.706	Q1LYC2_DANRE Transcription initiation factor TFIID subunit OS=Danio rerio OX=7955 GN=wu:fi04f03 PE=1 SV=1
7	Q60544	0.0	3758	1865	0.967	0.971	TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus OX=10036 GN=TAF1 PE=2 SV=1
8	Q80UV9	0.0	3398	1891	0.957	0.947	TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus OX=10090 GN=Taf1 PE=1 SV=2
9	Q8IZX4	0.0	3218	1826	0.896	0.919	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1
10	Q8LRK9	6.98e-67	254	1919	0.083	0.081	TAF1_ARATH Transcription initiation factor TFIID subunit 1 OS=Arabidopsis thaliana OX=3702 GN=TAF1 PE=1 SV=1
11	Q09813	1.73e-63	238	979	0.117	0.224	T111_SCHPO Putative transcription initiation factor TFIID 111 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2G11.14 PE=1 SV=1
12	Q6PUA2	3.33e-59	228	1786	0.079	0.082	TAF1B_ARATH Transcription initiation factor TFIID subunit 1b OS=Arabidopsis thaliana OX=3702 GN=TAF1B PE=2 SV=1
13	P46677	2.99e-58	223	1066	0.090	0.159	TAF1_YEAST Transcription initiation factor TFIID subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF1 PE=1 SV=1
14	Q86U86	3.45e-14	81.3	1689	0.033	0.036	PB1_HUMAN Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=1
15	A0A8I5ZMW9	3.99e-14	80.9	1704	0.032	0.035	A0A8I5ZMW9_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
16	E7EVG2	4.16e-14	80.9	1460	0.033	0.042	E7EVG2_HUMAN Polybromo 1 (Fragment) OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=8
17	D3ZT52	4.38e-14	80.9	1652	0.032	0.036	D3ZT52_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=3
18	A0A8I6AV81	5.48e-14	80.5	1624	0.032	0.037	A0A8I6AV81_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
19	Q8BSQ9	5.92e-14	80.5	1634	0.032	0.037	PB1_MOUSE Protein polybromo-1 OS=Mus musculus OX=10090 GN=Pbrm1 PE=1 SV=4
20	A0A8I6AR61	5.97e-14	80.5	1634	0.032	0.037	A0A8I6AR61_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	9.2e-39	142.7	Bromodomain
2	PF12157 DUF3591	8.3e-165	560.4	Protein of unknown function (DUF3591)
3	PF08618 Opi1	77	14.0	Transcription factor Opi1
4	PF09247 TBP-binding	3.7e-18	76.8	TATA box-binding protein binding
5	PF15288 zf-CCHC_6	1.6e-13	61.6	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406549

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
3	9606.ENSP00000269142	0.999	Transcription initiation factor TFIID subunit 4B
4	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
5	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
6	9606.ENSP00000339917	0.999	Transcription initiation factor TFIID subunit 9B
7	9606.ENSP00000340271	0.999	Transcription initiation factor TFIID subunit 3
8	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
9	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
10	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
11	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
12	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
13	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
14	9606.ENSP00000375942	0.999	TATA-box-binding protein
15	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
16	9606.ENSP00000377969	0.998	General transcription factor IIF subunit 1
17	9606.ENSP00000359531	0.993	Transcription initiation factor IIB
18	9606.ENSP00000269305	0.991	Cellular tumor antigen p53
19	9606.ENSP00000379372	0.989	Transcription initiation factor IIA subunit 2
20	9606.ENSP00000452454	0.987	Transcription initiation factor IIA subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	1.000	RNA polymerase II general transcription initiation factor activity
GO:0003677	1.000	DNA binding
GO:0004402	1.000	histone acetyltransferase activity
GO:0070577	0.999	lysine-acetylated histone binding
GO:0017025	0.995	TBP-class protein binding
GO:0043565	0.969	sequence-specific DNA binding
GO:0061629	0.943	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000976	0.929	transcription cis-regulatory region binding
GO:0001099	0.915	basal RNA polymerase II transcription machinery binding
GO:0016922	0.909	nuclear receptor binding
GO:0001091	0.908	RNA polymerase II general transcription initiation factor binding
GO:0000977	0.898	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0035064	0.887	methylated histone binding
GO:0001046	0.881	core promoter sequence-specific DNA binding
GO:0004842	0.880	ubiquitin-protein transferase activity
GO:0061631	0.858	ubiquitin conjugating enzyme activity
GO:0016772	0.852	transferase activity, transferring phosphorus-containing groups
GO:0098772	0.843	molecular function regulator activity
GO:0000979	0.842	RNA polymerase II core promoter sequence-specific DNA binding
GO:0016773	0.838	phosphotransferase activity, alcohol group as acceptor
GO:0140416	0.827	transcription regulator inhibitor activity
GO:0004672	0.826	protein kinase activity
GO:0002039	0.814	p53 binding
GO:0046982	0.813	protein heterodimerization activity
GO:0004674	0.766	protein serine/threonine kinase activity
GO:0001181	0.560	RNA polymerase I general transcription initiation factor activity
GO:0061628	0.559	H3K27me3 modified histone binding
GO:0003682	0.472	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0050794	0.972	regulation of cellular process
GO:0071704	0.967	organic substance metabolic process
GO:0019219	0.961	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.956	regulation of gene expression
GO:0051252	0.954	regulation of RNA metabolic process
GO:0048518	0.945	positive regulation of biological process
GO:0010556	0.945	regulation of macromolecule biosynthetic process
GO:0006807	0.937	nitrogen compound metabolic process
GO:0044237	0.937	cellular metabolic process
GO:0006355	0.935	regulation of DNA-templated transcription
GO:0009893	0.926	positive regulation of metabolic process
GO:0044238	0.919	primary metabolic process
GO:0051173	0.919	positive regulation of nitrogen compound metabolic process
GO:0050896	0.914	response to stimulus
GO:0043170	0.907	macromolecule metabolic process
GO:0048522	0.905	positive regulation of cellular process
GO:0006357	0.898	regulation of transcription by RNA polymerase II
GO:0045893	0.894	positive regulation of DNA-templated transcription
GO:0042221	0.755	response to chemical
GO:0006366	0.739	transcription by RNA polymerase II
GO:0071840	0.657	cellular component organization or biogenesis
GO:0016043	0.632	cellular component organization
GO:0009410	0.564	response to xenobiotic stimulus
GO:0043412	0.537	macromolecule modification
GO:0019538	0.536	protein metabolic process
GO:0036211	0.531	protein modification process
GO:0048519	0.518	negative regulation of biological process
GO:0045944	0.513	positive regulation of transcription by RNA polymerase II
GO:0048523	0.503	negative regulation of cellular process
GO:0051716	0.394	cellular response to stimulus
GO:0006352	0.384	DNA-templated transcription initiation
GO:0006367	0.374	transcription initiation at RNA polymerase II promoter
GO:0010605	0.318	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.995	nucleus
GO:0005654	0.976	nucleoplasm
GO:0032991	0.951	protein-containing complex
GO:0043232	0.942	intracellular non-membrane-bounded organelle
GO:1902494	0.883	catalytic complex
GO:0140513	0.807	nuclear protein-containing complex
GO:0005669	0.391	transcription factor TFIID complex
GO:0071339	0.380	MLL1 complex
GO:0005730	0.366	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.
EC:2.3.2.23	0.858	E2 ubiquitin-conjugating enzyme.
EC:2.7.-.-	0.852	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.838	Phosphotransferases with an alcohol group as acceptor.

[back to server]