StarFunc result for job id P21695

User Input

>input (349 residues)
MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHEN
VKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIK
GVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKEL
MQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP
ETARELYSILQHKGLVDKFPLFMAVYKVCYEGQPVGEFIHCLQNHPEHM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35077	0.998	0.998	4.964E-62	349	0.943	0.943	O35077.pdb.gz	GPDA_RAT Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Rattus norvegicus OX=10116 GN=Gpd1 PE=1 SV=4
2	PDB:1x0xA	0.988	0.985	4.785E-57	350	1.000	0.997	1x0xA.pdb.gz	Crystal Structures of Human Glycerol 3-phosphate Dehydrogenase 1 (GPD1)
3	AFDB:Q3ULJ0	0.992	0.987	1.824E-53	351	0.731	0.726	Q3ULJ0.pdb.gz	GPD1L_MOUSE Glycerol-3-phosphate dehydrogenase 1-like protein OS=Mus musculus OX=10090 GN=Gpd1l PE=1 SV=2
4	PDB:2plaA	0.967	0.984	3.826E-49	343	0.702	0.714	2plaA.pdb.gz	Crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein.
5	AFDB:P13706	0.946	0.910	9.514E-48	363	0.653	0.628	P13706.pdb.gz	GPDA_DROME Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Gpdh1 PE=1 SV=3
6	AFDB:P34517	0.985	0.877	1.458E-45	392	0.610	0.543	P34517.pdb.gz	GPDH2_CAEEL Probable glycerol-3-phosphate dehydrogenase 2 OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=3 SV=2
7	AFDB:Q09845	0.891	0.836	5.990E-41	373	0.516	0.483	Q09845.pdb.gz	GPD2_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd2 PE=1 SV=1
8	AFDB:P21696	0.920	0.837	1.351E-40	385	0.527	0.478	P21696.pdb.gz	GPD1_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd1 PE=1 SV=2
9	AFDB:Q00055	0.904	0.813	2.246E-40	391	0.484	0.432	Q00055.pdb.gz	GPD1_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPD1 PE=1 SV=4
10	AFDB:Q59W33	0.893	0.844	3.869E-39	371	0.487	0.458	Q59W33.pdb.gz	GPD2_CANAL Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPD2 PE=1 SV=1
11	AFDB:Q59XU9	0.914	0.796	9.181E-39	403	0.467	0.404	Q59XU9.pdb.gz	Q59XU9_CANAL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPD1 PE=3 SV=1
12	AFDB:Q6FWJ7	0.900	0.753	2.412E-38	422	0.484	0.400	Q6FWJ7.pdb.gz	GPD2_CANGA Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GPD2 PE=3 SV=1
13	PDB:4fgwA	0.858	0.849	1.118E-35	353	0.481	0.476	4fgwA.pdb.gz
14	PDB:6xp1B	0.398	0.481	4.617E-8	281	0.138	0.171	6xp1B.pdb.gz	In crystallo screening for proline analog inhibitors of the proline cycle enzyme PYCR1.
15	PDB:4ol9A	0.507	0.582	3.526E-7	297	0.117	0.138	4ol9A.pdb.gz	Crystal Structure of putative 2-dehydropantoate 2-reductase PanE from Mycobacterium tuberculosis complexed with NADP and oxamate
16	PDB:2ofpB	0.496	0.572	3.904E-7	294	0.117	0.139	2ofpB.pdb.gz	Crystal Structure of Escherichia coli Ketopantoate Reductase in a Ternary Complex with NADP+ and Pantoate Bound: SUBSTRATE RECOGNITION, CONFORMATIONAL CHANGE, AND COOPERATIVITY.
17	PDB:6lhmD	0.387	0.481	6.490E-7	273	0.158	0.201	6lhmD.pdb.gz
18	PDB:1mfzA	0.442	0.363	7.953E-7	436	0.163	0.131	1mfzA.pdb.gz	The crystal structure of GDP-mannose dehydrogenase: A key enzyme in alginate biosynthesis of P. aeruginosa
19	PDB:6hcyC	0.312	0.259	7.953E-7	436	0.129	0.103	6hcyC.pdb.gz	Cryo-EM structures of human STEAP4 reveal mechanism of iron(III) reduction.
20	PDB:6jx2B	0.339	0.355	1.135E-6	327	0.163	0.174	6jx2B.pdb.gz	Crystal Structure and Biochemical Characterization of Ketol-Acid Reductoisomerase fromCorynebacterium glutamicum.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35077	0.0	678	349	0.943	0.943	GPDA_RAT Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Rattus norvegicus OX=10116 GN=Gpd1 PE=1 SV=4
2	P13707	0.0	679	349	0.940	0.940	GPDA_MOUSE Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Mus musculus OX=10090 GN=Gpd1 PE=1 SV=3
3	P21695	0.0	714	349	1.000	1.000	GPDA_HUMAN Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Homo sapiens OX=9606 GN=GPD1 PE=1 SV=4
4	Q3ULJ0	0.0	545	351	0.731	0.726	GPD1L_MOUSE Glycerol-3-phosphate dehydrogenase 1-like protein OS=Mus musculus OX=10090 GN=Gpd1l PE=1 SV=2
5	Q8N335	0.0	535	351	0.713	0.709	GPD1L_HUMAN Glycerol-3-phosphate dehydrogenase 1-like protein OS=Homo sapiens OX=9606 GN=GPD1L PE=1 SV=1
6	P13706	1.41e-157	447	363	0.665	0.639	GPDA_DROME Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Gpdh1 PE=1 SV=3
7	Q7JMU1	3.17e-149	427	371	0.616	0.580	Q7JMU1_CAEEL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=1 SV=1
8	A7LPE6	2.01e-147	422	360	0.613	0.594	A7LPE6_CAEEL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=1 SV=1
9	P34517	2.33e-147	423	392	0.613	0.546	GPDH2_CAEEL Probable glycerol-3-phosphate dehydrogenase 2 OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=3 SV=2
10	A7LPE5	1.27e-121	354	304	0.547	0.628	A7LPE5_CAEEL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=1 SV=1
11	P21696	5.51e-116	343	385	0.530	0.481	GPD1_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd1 PE=1 SV=2
12	Q09845	8.41e-112	332	373	0.516	0.483	GPD2_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd2 PE=1 SV=1
13	Q00055	1.46e-111	332	391	0.481	0.430	GPD1_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPD1 PE=1 SV=4
14	Q6FWJ7	6.96e-109	326	422	0.484	0.400	GPD2_CANGA Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GPD2 PE=3 SV=1
15	Q59W33	1.25e-103	311	371	0.490	0.461	GPD2_CANAL Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPD2 PE=1 SV=1
16	Q59XU9	2.45e-103	311	403	0.464	0.402	Q59XU9_CANAL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPD1 PE=3 SV=1
17	P41911	3.22e-103	312	440	0.458	0.364	GPD2_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPD2 PE=1 SV=2
18	C8VTT9	6.56e-90	280	485	0.504	0.363	C8VTT9_EMENI Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00351 PE=3 SV=1
19	Q97NF1	5.47e-41	148	338	0.307	0.317	GPDA_STRPN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gpsA PE=1 SV=1
20	P46919	1.44e-40	147	345	0.307	0.310	GPDA_BACSU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus subtilis (strain 168) OX=224308 GN=gpsA PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	4.8e+02	11.5	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF03807 F420_oxidored	5.1	19.1	NADP oxidoreductase coenzyme F420-dependent
3	PF20618 GPD_NAD_C_bact	1.8	20.5	Bacterial GPD, NAD-dependent C-terminal
4	PF07479 NAD_Gly3P_dh_C	5.7e-44	161.3	NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
5	PF01210 NAD_Gly3P_dh_N	7.1e-52	187.0	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301149

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308610	0.963	Glycerol-3-phosphate dehydrogenase, mitochondrial
2	9606.ENSP00000265276	0.953	Glycerol-3-phosphate acyltransferase 1, mitochondrial
3	9606.ENSP00000355607	0.952	Glyceronephosphate O-acyltransferase
4	9606.ENSP00000389395	0.925	Glycerol-3-phosphate acyltransferase 2, mitochondrial
5	9606.ENSP00000482571	0.924	Glycerol-3-phosphate acyltransferase 3
6	9606.ENSP00000380184	0.916	Glycerol-3-phosphate acyltransferase 4
7	9606.ENSP00000378360	0.903	Triokinase/FMN cyclase
8	9606.ENSP00000369099	0.902	Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
9	9606.ENSP00000216410	0.873	Glucosamine-phosphate N-acetyltransferase 1
10	9606.ENSP00000282541	0.828	Glycerol-3-phosphate dehydrogenase 1-like protein
11	9606.ENSP00000381302	0.808	Phospholipid phosphatase 4
12	9606.ENSP00000392553	0.808	Phospholipid phosphatase 5
13	9606.ENSP00000360761	0.764	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
14	9606.ENSP00000381140	0.745	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
15	9606.ENSP00000351209	0.742	Ephrin type-A receptor 2
16	9606.ENSP00000397908	0.721	Phosphatidate phosphatase LPIN1
17	9606.ENSP00000302177	0.701	Lysophospholipid acyltransferase 2
18	9606.ENSP00000330442	0.694	Phospholipase B1, membrane-associated
19	9606.ENSP00000310551	0.682	Lysocardiolipin acyltransferase 1
20	9606.ENSP00000261596	0.678	Phosphatidate phosphatase LPIN2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047952	1.000	glycerol-3-phosphate dehydrogenase [NAD(P)+] activity
GO:0005488	0.998	binding
GO:0005515	0.979	protein binding
GO:0097159	0.517	organic cyclic compound binding
GO:1901363	0.484	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0006793	0.991	phosphorus metabolic process
GO:0006796	0.963	phosphate-containing compound metabolic process
GO:0044281	0.962	small molecule metabolic process
GO:0019637	0.960	organophosphate metabolic process
GO:0005975	0.793	carbohydrate metabolic process
GO:0006807	0.704	nitrogen compound metabolic process
GO:0055086	0.513	nucleobase-containing small molecule metabolic process
GO:1901564	0.485	organonitrogen compound metabolic process
GO:0006629	0.459	lipid metabolic process
GO:0044255	0.446	cellular lipid metabolic process
GO:0046486	0.377	glycerolipid metabolic process
GO:1901135	0.353	carbohydrate derivative metabolic process
GO:0006753	0.348	nucleoside phosphate metabolic process
GO:0065007	0.327	biological regulation
GO:0009117	0.324	nucleotide metabolic process
GO:0006163	0.313	purine nucleotide metabolic process
GO:0050789	0.307	regulation of biological process
GO:0050896	0.302	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.988	organelle
GO:0043227	0.970	membrane-bounded organelle
GO:0005576	0.953	extracellular region
GO:0043229	0.904	intracellular organelle
GO:0043231	0.845	intracellular membrane-bounded organelle
GO:0016020	0.841	membrane
GO:0005615	0.801	extracellular space
GO:1903561	0.801	extracellular vesicle
GO:0070062	0.780	extracellular exosome
GO:0043233	0.408	organelle lumen
GO:0070013	0.321	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.94	1.000	glycerol-3-phosphate dehydrogenase [NAD(P)(+)].
EC:1.1.1.8	1.000	glycerol-3-phosphate dehydrogenase (NAD(+)).

[back to server]