StarFunc result for job id P21709

User Input

>input (976 residues)
MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNG
TPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKE
TFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRG
LYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGTCLPHARASPR
PSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEACVACPSGSYRMDMDTPHCLTCPQQ
STAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSLRWEPPADTGG
RQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPGARGLTTPAVHVNGLEPYANYTFNVE
AQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLT
YELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVS
RGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKPYV
DLQAYEDPAQGALDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKD
TSPGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDAFLREREDQ
LVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGT
YETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIE
DGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRM
TLRLPSLSGSDGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITL
PGHQKRILCSIQGFKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.387	0.337	0.000	1130	0.435	0.376	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:D3ZDH4	0.680	0.679	0.000	977	0.882	0.881	D3ZDH4.pdb.gz	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
3	AFDB:F1RCL1	0.383	0.383	0.000	976	0.432	0.432	F1RCL1.pdb.gz
4	AFDB:P21709	1.000	1.000	0.000	976	1.000	1.000	P21709.pdb.gz	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4
5	AFDB:P54759	0.380	0.372	0.000	998	0.442	0.432	P54759.pdb.gz	EPHA7_RAT Ephrin type-A receptor 7 OS=Rattus norvegicus OX=10116 GN=Epha7 PE=1 SV=1
6	AFDB:P54764	0.392	0.388	0.000	986	0.445	0.440	P54764.pdb.gz	EPHA4_HUMAN Ephrin type-A receptor 4 OS=Homo sapiens OX=9606 GN=EPHA4 PE=1 SV=1
7	AFDB:Q03145	0.404	0.404	5.428E-104	977	0.483	0.482	Q03145.pdb.gz	EPHA2_MOUSE Ephrin type-A receptor 2 OS=Mus musculus OX=10090 GN=Epha2 PE=1 SV=3
8	AFDB:P54756	0.366	0.346	1.454E-103	1037	0.436	0.411	P54756.pdb.gz	EPHA5_HUMAN Ephrin type-A receptor 5 OS=Homo sapiens OX=9606 GN=EPHA5 PE=1 SV=3
9	AFDB:A0A0G2JY48	0.353	0.350	2.177E-102	986	0.413	0.409	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
10	AFDB:P29322	0.385	0.375	6.753E-102	1005	0.418	0.406	P29322.pdb.gz	EPHA8_HUMAN Ephrin type-A receptor 8 OS=Homo sapiens OX=9606 GN=EPHA8 PE=1 SV=2
11	PDB:1k9aB	0.250	0.542	5.326E-22	441	0.111	0.245	1k9aB.pdb.gz
12	PDB:2h8hA	0.243	0.511	4.880E-21	445	0.154	0.337	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.246	0.425	3.496E-20	555	0.103	0.182	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.252	0.435	1.457E-19	551	0.106	0.187	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:4rerA	0.243	0.497	8.528E-15	459	0.074	0.157	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:8dksA	0.219	0.697	8.528E-15	283	0.074	0.254	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:5ufuA	0.242	0.608	1.204E-14	369	0.073	0.192	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:4rewA	0.240	0.543	1.699E-14	411	0.076	0.180	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:2qkwB	0.233	0.718	2.919E-14	292	0.079	0.264	2qkwB.pdb.gz
20	PDB:4zhxA	0.239	0.543	3.734E-14	409	0.067	0.159	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	757	1130	0.439	0.379	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	722	965	0.418	0.423	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	784	983	0.432	0.429	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	724	1055	0.417	0.386	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	713	946	0.407	0.420	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	744	986	0.423	0.419	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	758	918	0.420	0.447	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D3ZDH4	1684	977	0.862	0.861	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
9	D3ZZK3	786	949	0.440	0.452	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
10	F1MAJ0	740	987	0.423	0.418	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
11	O08644	596	1014	0.383	0.369	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
12	O08680	773	984	0.430	0.427	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
13	O09127	716	1004	0.419	0.407	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
14	O15197	593	1021	0.386	0.369	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
15	O73875	680	987	0.424	0.419	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
16	O73878	703	976	0.420	0.420	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
17	P09759	756	984	0.432	0.429	EPHB1_RAT Ephrin type-B receptor 1 OS=Rattus norvegicus OX=10116 GN=Ephb1 PE=1 SV=2
18	P21709	2016	976	1.000	1.000	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4
19	P28693	751	1004	0.431	0.419	EPHB2_CHICK Ephrin type-B receptor 2 OS=Gallus gallus OX=9031 GN=EPHB2 PE=1 SV=3
20	P29317	915	976	0.498	0.498	EPHA2_HUMAN Ephrin type-A receptor 2 OS=Homo sapiens OX=9606 GN=EPHA2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	26	15.4	ABC1 atypical kinase-like domain
2	PF14575 EphA2_TM	7.5e-13	60.4	Ephrin type-A receptor 2 transmembrane domain
3	PF01404 Ephrin_lbd	2.2e-52	189.3	Ephrin receptor ligand binding domain
4	PF07699 Ephrin_rec_like	0.079	24.1	Tyrosine-protein kinase ephrin type A/B receptor-like
5	PF00041 fn3	2e-22	90.7	Fibronectin type III domain
6	PF12330 Haspin_kinase	3e+02	11.7	Haspin like kinase domain
7	PF06293 Kdo	1.5e+02	13.2	Lipopolysaccharide kinase (Kdo/WaaP) family
8	PF00069 Pkinase	1.1e-40	151.3	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	2e-91	317.4	Protein tyrosine and serine/threonine kinase
10	PF16656 Pur_ac_phosph_N	0.021	26.8	Purple acid Phosphatase, N-terminal domain
11	PF00536 SAM_1	4.1e-19	80.1	SAM domain (Sterile alpha motif)
12	PF07647 SAM_2	9.7e-12	56.1	SAM domain (Sterile alpha motif)
13	PF01108 Tissue_fac	4.1e+02	12.2	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000275815

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357392	0.999	Ephrin-A1
2	9606.ENSP00000264051	0.994	Ephexin-1
3	9606.ENSP00000245323	0.993	Ephrin-B2
4	9606.ENSP00000204961	0.986	Ephrin-B1
5	9606.ENSP00000351209	0.980	Ephrin type-A receptor 2
6	9606.ENSP00000328777	0.967	Ephrin-A5
7	9606.ENSP00000226091	0.965	Ephrin-B3
8	9606.ENSP00000400175	0.961	Transforming protein RhoA
9	9606.ENSP00000264033	0.943	E3 ubiquitin-protein ligase CBL
10	9606.ENSP00000260408	0.942	Disintegrin and metalloproteinase domain-containing protein 10
11	9606.ENSP00000215368	0.941	Ephrin-A2
12	9606.ENSP00000357393	0.929	Ephrin-A3
13	9606.ENSP00000323588	0.918	Transcription factor SOX-2
14	9606.ENSP00000346671	0.918	Tyrosine-protein kinase Fyn
15	9606.ENSP00000259915	0.916	POU domain, class 5, transcription factor 1
16	9606.ENSP00000229307	0.915	Homeobox protein NANOG
17	9606.ENSP00000362680	0.914	Proto-oncogene tyrosine-protein kinase Src
18	9606.ENSP00000414378	0.914	Ephrin-A4
19	9606.ENSP00000337825	0.911	Tyrosine-protein kinase Lck
20	9606.ENSP00000281821	0.907	Ephrin type-A receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005003	1.000	ephrin receptor activity
GO:0019899	0.504	enzyme binding
GO:0005005	0.441	transmembrane-ephrin receptor activity
GO:0001968	0.367	fibronectin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048518	0.989	positive regulation of biological process
GO:0050896	0.980	response to stimulus
GO:0048522	0.969	positive regulation of cellular process
GO:0051716	0.907	cellular response to stimulus
GO:0032970	0.880	regulation of actin filament-based process
GO:0051239	0.861	regulation of multicellular organismal process
GO:0007154	0.850	cell communication
GO:0050793	0.834	regulation of developmental process
GO:0023052	0.826	signaling
GO:0044087	0.826	regulation of cellular component biogenesis
GO:0022603	0.817	regulation of anatomical structure morphogenesis
GO:0051130	0.811	positive regulation of cellular component organization
GO:0071704	0.804	organic substance metabolic process
GO:1901342	0.804	regulation of vasculature development
GO:0032502	0.779	developmental process
GO:0032501	0.755	multicellular organismal process
GO:0007165	0.755	signal transduction
GO:0048856	0.753	anatomical structure development
GO:0048519	0.718	negative regulation of biological process
GO:0051094	0.703	positive regulation of developmental process
GO:0051240	0.679	positive regulation of multicellular organismal process
GO:0043170	0.675	macromolecule metabolic process
GO:0044238	0.656	primary metabolic process
GO:0007275	0.639	multicellular organism development
GO:0032956	0.627	regulation of actin cytoskeleton organization
GO:0065009	0.626	regulation of molecular function
GO:0006807	0.610	nitrogen compound metabolic process
GO:0044237	0.593	cellular metabolic process
GO:0048583	0.575	regulation of response to stimulus
GO:0050790	0.572	regulation of catalytic activity
GO:0048731	0.561	system development
GO:0030155	0.554	regulation of cell adhesion
GO:0019222	0.519	regulation of metabolic process
GO:0048523	0.512	negative regulation of cellular process
GO:1901564	0.507	organonitrogen compound metabolic process
GO:0040012	0.492	regulation of locomotion
GO:0080090	0.487	regulation of primary metabolic process
GO:0060255	0.487	regulation of macromolecule metabolic process
GO:0051171	0.481	regulation of nitrogen compound metabolic process
GO:0019538	0.481	protein metabolic process
GO:0045765	0.480	regulation of angiogenesis
GO:0007166	0.464	cell surface receptor signaling pathway
GO:0031323	0.455	regulation of cellular metabolic process
GO:1904018	0.427	positive regulation of vasculature development
GO:0045766	0.392	positive regulation of angiogenesis
GO:0007169	0.386	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009893	0.385	positive regulation of metabolic process
GO:0044089	0.367	positive regulation of cellular component biogenesis
GO:0010604	0.367	positive regulation of macromolecule metabolic process
GO:1902905	0.367	positive regulation of supramolecular fiber organization
GO:0010646	0.364	regulation of cell communication
GO:0006796	0.363	phosphate-containing compound metabolic process
GO:0036211	0.361	protein modification process
GO:0110053	0.356	regulation of actin filament organization
GO:0051495	0.351	positive regulation of cytoskeleton organization
GO:0016310	0.350	phosphorylation
GO:0048584	0.349	positive regulation of response to stimulus
GO:0044093	0.339	positive regulation of molecular function
GO:0007155	0.336	cell adhesion
GO:0110020	0.333	regulation of actomyosin structure organization
GO:0042221	0.332	response to chemical
GO:0051173	0.332	positive regulation of nitrogen compound metabolic process
GO:0023051	0.330	regulation of signaling
GO:0051246	0.326	regulation of protein metabolic process
GO:2000145	0.325	regulation of cell motility
GO:0009966	0.320	regulation of signal transduction
GO:0051336	0.311	regulation of hydrolase activity
GO:0051496	0.311	positive regulation of stress fiber assembly
GO:0016043	0.305	cellular component organization
GO:0043085	0.300	positive regulation of catalytic activity
GO:0030334	0.300	regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.813	intracellular anatomical structure
GO:0005737	0.770	cytoplasm
GO:0043227	0.745	membrane-bounded organelle
GO:0043231	0.624	intracellular membrane-bounded organelle
GO:0005829	0.520	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]