StarFunc result for job id P21730

User Input

>input (350 residues)
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21730	1.000	1.000	2.594E-48	350	1.000	1.000	P21730.pdb.gz	C5AR1_HUMAN C5a anaphylatoxin chemotactic receptor 1 OS=Homo sapiens OX=9606 GN=C5AR1 PE=1 SV=2
2	AFDB:P97520	0.899	0.894	4.367E-33	352	0.671	0.668	P97520.pdb.gz	C5AR1_RAT C5a anaphylatoxin chemotactic receptor 1 OS=Rattus norvegicus OX=10116 GN=C5ar1 PE=1 SV=1
3	AFDB:P30993	0.864	0.861	3.832E-32	351	0.657	0.655	P30993.pdb.gz	C5AR1_MOUSE C5a anaphylatoxin chemotactic receptor 1 OS=Mus musculus OX=10090 GN=C5ar1 PE=1 SV=2
4	AFDB:O88536	0.793	0.791	3.009E-21	351	0.309	0.308	O88536.pdb.gz	FPR2_MOUSE Formyl peptide receptor 2 OS=Mus musculus OX=10090 GN=Fpr2 PE=1 SV=1
5	AFDB:P25090	0.802	0.800	6.985E-21	351	0.337	0.336	P25090.pdb.gz	FPR2_HUMAN N-formyl peptide receptor 2 OS=Homo sapiens OX=9606 GN=FPR2 PE=1 SV=2
6	AFDB:A0A060YND6	0.791	0.791	4.299E-20	350	0.349	0.349	A0A060YND6.pdb.gz	A0A060YND6_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00034199001 PE=3 SV=1
7	AFDB:Q9P296	0.800	0.829	4.122E-19	337	0.357	0.371	Q9P296.pdb.gz	C5AR2_HUMAN C5a anaphylatoxin chemotactic receptor 2 OS=Homo sapiens OX=9606 GN=C5AR2 PE=1 SV=1
8	AFDB:D4A8L8	0.796	0.794	5.377E-19	351	0.300	0.299	D4A8L8.pdb.gz	D4A8L8_RAT Formyl peptide receptor 3 OS=Rattus norvegicus OX=10116 GN=Fpr3 PE=3 SV=2
9	AFDB:Q695P6	0.788	0.803	1.000E-18	343	0.329	0.335	Q695P6.pdb.gz	C5AR2_RAT C5a anaphylatoxin chemotactic receptor 2 OS=Rattus norvegicus OX=10116 GN=C5ar2 PE=1 SV=1
10	AFDB:P33766	0.721	0.696	4.718E-18	364	0.317	0.305	P33766.pdb.gz	FPR1_MOUSE fMet-Leu-Phe receptor OS=Mus musculus OX=10090 GN=Fpr1 PE=2 SV=1
11	PDB:6lw5A	0.720	0.598	5.339E-16	427	0.297	0.244	6lw5A.pdb.gz	Structural basis of ligand binding modes at the human formyl peptide receptor 2.
12	PDB:7wvuR	0.702	0.816	9.108E-15	298	0.257	0.302	7wvuR.pdb.gz	Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
13	PDB:7wicR	0.689	0.826	1.698E-13	288	0.254	0.309	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
14	PDB:8ef5M	0.687	0.824	3.770E-13	288	0.217	0.264	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
15	PDB:7wq3R	0.670	0.799	7.330E-13	289	0.214	0.260	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
16	PDB:7vktA	0.714	0.861	7.662E-13	287	0.243	0.296	7vktA.pdb.gz	Structural basis of leukotriene B4 receptor 1 activation.
17	PDB:7vl9R	0.684	0.784	2.031E-12	302	0.214	0.248	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
18	PDB:7f6hA	0.680	0.774	3.778E-12	305	0.214	0.246	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
19	PDB:5zbqA	0.674	0.517	8.027E-12	463	0.200	0.151	5zbqA.pdb.gz	Structural basis of ligand binding modes at the neuropeptide Y Y1receptor
20	PDB:7wq4R	0.660	0.805	8.027E-12	282	0.231	0.287	7wq4R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21730	0.0	711	350	1.000	1.000	C5AR1_HUMAN C5a anaphylatoxin chemotactic receptor 1 OS=Homo sapiens OX=9606 GN=C5AR1 PE=1 SV=2
2	P30993	5.69e-167	471	351	0.657	0.655	C5AR1_MOUSE C5a anaphylatoxin chemotactic receptor 1 OS=Mus musculus OX=10090 GN=C5ar1 PE=1 SV=2
3	P97520	1.70e-166	470	352	0.669	0.665	C5AR1_RAT C5a anaphylatoxin chemotactic receptor 1 OS=Rattus norvegicus OX=10116 GN=C5ar1 PE=1 SV=1
4	Q9P296	5.45e-68	218	337	0.377	0.392	C5AR2_HUMAN C5a anaphylatoxin chemotactic receptor 2 OS=Homo sapiens OX=9606 GN=C5AR2 PE=1 SV=1
5	E7FF45	5.87e-66	214	372	0.354	0.333	E7FF45_DANRE Chemokine-like receptor 1 OS=Danio rerio OX=7955 GN=fpr1 PE=3 SV=1
6	Q695P6	1.54e-59	197	343	0.354	0.362	C5AR2_RAT C5a anaphylatoxin chemotactic receptor 2 OS=Rattus norvegicus OX=10116 GN=C5ar2 PE=1 SV=1
7	P33766	3.24e-59	197	364	0.334	0.321	FPR1_MOUSE fMet-Leu-Phe receptor OS=Mus musculus OX=10090 GN=Fpr1 PE=2 SV=1
8	D4A7Q2	1.84e-58	194	355	0.337	0.332	D4A7Q2_RAT Formyl peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Fpr1 PE=3 SV=1
9	P25090	7.95e-55	185	351	0.331	0.330	FPR2_HUMAN N-formyl peptide receptor 2 OS=Homo sapiens OX=9606 GN=FPR2 PE=1 SV=2
10	O88536	1.52e-54	184	351	0.311	0.311	FPR2_MOUSE Formyl peptide receptor 2 OS=Mus musculus OX=10090 GN=Fpr2 PE=1 SV=1
11	P97468	1.33e-53	182	371	0.337	0.318	CML1_MOUSE Chemerin-like receptor 1 OS=Mus musculus OX=10090 GN=Cmklr1 PE=1 SV=1
12	Q99788	1.84e-53	182	373	0.351	0.330	CML1_HUMAN Chemerin-like receptor 1 OS=Homo sapiens OX=9606 GN=CMKLR1 PE=1 SV=2
13	P25089	2.11e-53	181	353	0.314	0.312	FPR3_HUMAN N-formyl peptide receptor 3 OS=Homo sapiens OX=9606 GN=FPR3 PE=2 SV=2
14	O35786	6.36e-53	181	372	0.320	0.301	CML1_RAT Chemerin-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Cmklr1 PE=1 SV=2
15	A0A8I6AM80	1.17e-52	179	351	0.337	0.336	A0A8I6AM80_RAT Formyl peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Fpr2 PE=3 SV=1
16	P21462	3.60e-52	178	350	0.314	0.314	FPR1_HUMAN fMet-Leu-Phe receptor OS=Homo sapiens OX=9606 GN=FPR1 PE=1 SV=3
17	A0A060YND6	8.82e-50	172	350	0.360	0.360	A0A060YND6_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00034199001 PE=3 SV=1
18	Q6UNA4	8.82e-50	172	350	0.360	0.360	C5AR1_ONCMY C5a anaphylatoxin chemotactic receptor 1 OS=Oncorhynchus mykiss OX=8022 GN=c5ar1 PE=2 SV=1
19	O08790	6.99e-49	169	351	0.303	0.302	FPRS1_MOUSE Formyl peptide receptor-related sequence 1 OS=Mus musculus OX=10090 GN=Fpr-s1 PE=1 SV=2
20	O88537	1.07e-48	169	343	0.294	0.300	FPRS3_MOUSE Formyl peptide receptor-related sequence 3 OS=Mus musculus OX=10090 GN=Fpr-rs3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.8e-41	153.8	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	0.0062	27.5	Serpentine type 7TM GPCR chemoreceptor Srsx
3	PF10323 7TM_GPCR_Srv	2.3	19.1	Serpentine type 7TM GPCR chemoreceptor Srv
4	PF10324 7TM_GPCR_Srw	4e+02	11.7	Serpentine type 7TM GPCR chemoreceptor Srw
5	PF10328 7TM_GPCR_Srx	3.7	18.6	Serpentine type 7TM GPCR chemoreceptor Srx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347197

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223642	0.998	Complement C5
2	9606.ENSP00000260010	0.987	Toll-like receptor 2
3	9606.ENSP00000470972	0.985	40S ribosomal protein S19
4	9606.ENSP00000245907	0.935	Complement C3
5	9606.ENSP00000363089	0.926	Toll-like receptor 4
6	9606.ENSP00000247153	0.738	Properdin
7	9606.ENSP00000421725	0.724	Vitamin D-binding protein
8	9606.ENSP00000441691	0.707	Integrin alpha-M
9	9606.ENSP00000302079	0.706	C3a anaphylatoxin chemotactic receptor
10	9606.ENSP00000356016	0.704	Complement receptor type 1
11	9606.ENSP00000396688	0.703	Complement C4-A
12	9606.ENSP00000415941	0.703	Complement C4-B
13	9606.ENSP00000356030	0.700	Complement decay-accelerating factor
14	9606.ENSP00000268389	0.696	Immunoglobulin superfamily member 6
15	9606.ENSP00000354499	0.690	Cytochrome c oxidase subunit 1
16	9606.ENSP00000386444	0.689	S-arrestin
17	9606.ENSP00000313967	0.686	Complement C1q subcomponent subunit B
18	9606.ENSP00000313875	0.681	Membrane cofactor protein
19	9606.ENSP00000385035	0.665	Complement C1s subcomponent
20	9606.ENSP00000365891	0.647	Wiskott-Aldrich syndrome protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140375	1.000	immune receptor activity
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005488	0.991	binding
GO:0005515	0.982	protein binding
GO:0008528	0.823	G protein-coupled peptide receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0065007	0.995	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0051716	0.968	cellular response to stimulus
GO:0048518	0.890	positive regulation of biological process
GO:0007154	0.880	cell communication
GO:0023052	0.876	signaling
GO:0048583	0.864	regulation of response to stimulus
GO:0007165	0.842	signal transduction
GO:0009605	0.833	response to external stimulus
GO:0002682	0.815	regulation of immune system process
GO:0002376	0.811	immune system process
GO:0048522	0.744	positive regulation of cellular process
GO:0048584	0.711	positive regulation of response to stimulus
GO:0032501	0.680	multicellular organismal process
GO:0042221	0.619	response to chemical
GO:0002684	0.612	positive regulation of immune system process
GO:0006950	0.534	response to stress
GO:0019222	0.471	regulation of metabolic process
GO:0006952	0.467	defense response
GO:0006955	0.452	immune response
GO:0051239	0.422	regulation of multicellular organismal process
GO:0032101	0.411	regulation of response to external stimulus
GO:0044419	0.402	biological process involved in interspecies interaction between organisms
GO:0043207	0.388	response to external biotic stimulus
GO:0048519	0.373	negative regulation of biological process
GO:0060255	0.371	regulation of macromolecule metabolic process
GO:0051707	0.365	response to other organism
GO:0009893	0.340	positive regulation of metabolic process
GO:0032502	0.333	developmental process
GO:0010468	0.328	regulation of gene expression
GO:0051240	0.317	positive regulation of multicellular organismal process
GO:0048856	0.313	anatomical structure development
GO:0010604	0.313	positive regulation of macromolecule metabolic process
GO:0048523	0.310	negative regulation of cellular process
GO:0010033	0.306	response to organic substance
GO:0007186	0.301	G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.890	membrane-bounded organelle
GO:0005622	0.888	intracellular anatomical structure
GO:0005737	0.809	cytoplasm
GO:0031982	0.801	vesicle
GO:0043231	0.751	intracellular membrane-bounded organelle
GO:0012505	0.612	endomembrane system
GO:0031090	0.520	organelle membrane
GO:0030141	0.517	secretory granule
GO:0005576	0.499	extracellular region
GO:0030659	0.479	cytoplasmic vesicle membrane
GO:0005615	0.442	extracellular space
GO:0098588	0.355	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]