StarFunc result for job id P21741

User Input

>input (143 residues)
MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGT
CGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETI
RVTKPCTPKTKAKAKAKKGKGKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21741	1.000	1.000	5.131E-24	143	1.000	1.000	P21741.pdb.gz	MK_HUMAN Midkine OS=Homo sapiens OX=9606 GN=MDK PE=1 SV=1
2	AFDB:P12025	0.702	0.717	4.213E-20	140	0.860	0.879	P12025.pdb.gz	MK_MOUSE Midkine OS=Mus musculus OX=10090 GN=Mdk PE=1 SV=2
3	AFDB:P48530	0.561	0.565	2.020E-17	142	0.594	0.599	P48530.pdb.gz	MKA_XENLA Midkine-A OS=Xenopus laevis OX=8355 GN=mdk-a PE=2 SV=1
4	AFDB:A0A1D5NS41	0.400	0.376	6.309E-16	154	0.545	0.506	A0A1D5NS41.pdb.gz
5	AFDB:A0A0B5JK07	0.541	0.527	2.098E-15	147	0.545	0.531	A0A0B5JK07.pdb.gz
6	AFDB:P48533	0.631	0.570	7.720E-14	161	0.483	0.429	P48533.pdb.gz	PTNB_XENLA Pleiotrophin-B OS=Xenopus laevis OX=8355 GN=ptn-b PE=2 SV=1
7	AFDB:P21246	0.623	0.539	2.180E-13	168	0.469	0.399	P21246.pdb.gz	PTN_HUMAN Pleiotrophin OS=Homo sapiens OX=9606 GN=PTN PE=1 SV=1
8	AFDB:A0A0B5JW32	0.430	0.397	2.411E-12	158	0.448	0.405	A0A0B5JW32.pdb.gz
9	PDB:2lutA	0.306	0.348	2.758E-10	125	0.531	0.608	2lutA.pdb.gz
10	PDB:2luuA	0.302	0.336	1.273E-9	127	0.497	0.559	2luuA.pdb.gz
11	PDB:2n6fA	0.380	0.396	8.156E-9	136	0.441	0.463	2n6fA.pdb.gz
12	AFDB:A0A1D5NSV1	0.308	0.393	1.317E-5	110	0.294	0.382	A0A1D5NSV1.pdb.gz
13	AFDB:Q9W0S5	0.289	0.227	2.118E-3	185	0.175	0.135	Q9W0S5.pdb.gz	Q9W0S5_DROME Midkine and pleiotrophin 1, isoform A OS=Drosophila melanogaster OX=7227 GN=miple1 PE=2 SV=2
14	PDB:4a5wB	0.233	0.047	1.667E-2	871	0.147	0.024	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
15	PDB:4e0sB	0.214	0.043	4.706E-2	898	0.140	0.022	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
16	PDB:3ojyB	0.205	0.067	1.482E-1	504	0.063	0.018	3ojyB.pdb.gz	Structure of human C8 protein provides mechanistic insight into membrane pore formation by complement.
17	PDB:7nydG	0.195	0.079	4.667E-1	413	0.070	0.024	7nydG.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:3o2yA	0.172	0.157	4.929E-1	160	0.049	0.044	3o2yA.pdb.gz
19	PDB:1w0rA	0.201	0.077	5.807E-1	442	0.161	0.052	1w0rA.pdb.gz
20	PDB:5t43A	0.156	0.142	6.133E-1	158	0.028	0.025	5t43A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21741	3.27e-101	288	143	1.000	1.000	MK_HUMAN Midkine OS=Homo sapiens OX=9606 GN=MDK PE=1 SV=1
2	P12025	4.11e-61	186	140	0.762	0.779	MK_MOUSE Midkine OS=Mus musculus OX=10090 GN=Mdk PE=1 SV=2
3	Q9R1S9	7.43e-61	186	140	0.762	0.779	MK_RAT Midkine OS=Rattus norvegicus OX=10116 GN=Mdk PE=2 SV=1
4	P48530	5.40e-48	153	142	0.517	0.521	MKA_XENLA Midkine-A OS=Xenopus laevis OX=8355 GN=mdk-a PE=2 SV=1
5	Q9W767	9.22e-46	147	146	0.517	0.507	Q9W767_DANRE Midkine a OS=Danio rerio OX=7955 GN=zgc:86655 PE=1 SV=1
6	Q9DDG2	2.78e-44	144	147	0.462	0.449	Q9DDG2_DANRE Midkine b OS=Danio rerio OX=7955 GN=mdk2 PE=1 SV=1
7	P63089	5.78e-36	123	168	0.462	0.393	PTN_MOUSE Pleiotrophin OS=Mus musculus OX=10090 GN=Ptn PE=1 SV=1
8	P63090	5.78e-36	123	168	0.462	0.393	PTN_RAT Pleiotrophin OS=Rattus norvegicus OX=10116 GN=Ptn PE=1 SV=1
9	P21246	2.46e-34	119	168	0.385	0.327	PTN_HUMAN Pleiotrophin OS=Homo sapiens OX=9606 GN=PTN PE=1 SV=1
10	Q502U6	4.15e-34	118	158	0.455	0.411	Q502U6_DANRE Pleiotrophin OS=Danio rerio OX=7955 GN=zHBNF PE=1 SV=1
11	P32760	4.63e-34	118	165	0.413	0.358	PTN_CHICK Pleiotrophin OS=Gallus gallus OX=9031 GN=PTN PE=1 SV=2
12	P48533	6.40e-33	115	161	0.364	0.323	PTNB_XENLA Pleiotrophin-B OS=Xenopus laevis OX=8355 GN=ptn-b PE=2 SV=1
13	Q9Y0V9	1.9	30.0	185	0.126	0.097	Q9Y0V9_DROME Miple OS=Drosophila melanogaster OX=7227 GN=miple1 PE=2 SV=2
14	Q9W0S5	2.0	30.0	185	0.126	0.097	Q9W0S5_DROME Midkine and pleiotrophin 1, isoform A OS=Drosophila melanogaster OX=7227 GN=miple1 PE=2 SV=2
15	F1QQQ3	3.0	30.0	1253	0.098	0.011	F1QQQ3_DANRE Vitellogenin 3, phosvitinless OS=Danio rerio OX=7955 GN=cb1001 PE=1 SV=3
16	Q387W6	3.3	30.0	481	0.105	0.031	Q387W6_TRYB2 Methyltransferase type 11 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0900 PE=4 SV=1
17	Q9W0S4	9.5	28.5	279	0.112	0.057	Q9W0S4_DROME FI07208p OS=Drosophila melanogaster OX=7227 GN=miple2 PE=1 SV=1
18	M9PE21	9.7	28.5	281	0.112	0.057	M9PE21_DROME Midkine and pleiotrophin 2, isoform E OS=Drosophila melanogaster OX=7227 GN=miple2 PE=1 SV=1
19	Q9U3W4	9.8	28.5	279	0.112	0.057	Q9U3W4_DROME Miple2 OS=Drosophila melanogaster OX=7227 GN=miple2 PE=2 SV=1
20	Q8SZ83	9.9	28.5	279	0.112	0.057	Q8SZ83_DROME RE13914p OS=Drosophila melanogaster OX=7227 GN=miple2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01091 PTN_MK_C	1e-22	91.6	PTN/MK heparin-binding protein family, C-terminal domain
2	PF05196 PTN_MK_N	9.6e-24	94.7	PTN/MK heparin-binding protein family, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010369368.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010363624.1	0.735	ALK tyrosine kinase receptor
2	61622.XP_010375998.1	0.719	Cell surface proteoglycan that bears heparan sulfate.
3	61622.XP_010362173.1	0.666	Zinc fingers and homeoboxes protein 2
4	61622.XP_010355105.1	0.663	Protein tyrosine phosphatase, receptor type Z1
5	61622.XP_010370154.1	0.656	Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family
6	61622.XP_010371501.1	0.648	KRAS proto-oncogene, GTPase
7	61622.XP_010362739.1	0.640	Belongs to the integrin beta chain family.
8	61622.XP_010358948.1	0.639	Notch 2
9	61622.XP_010374588.1	0.631	Kinase suppressor of Ras 1 isoform X1
10	61622.XP_010358114.1	0.624	B-Raf proto-oncogene, serine/threonine kinase
11	61622.XP_010375599.1	0.609	RAF proto-oncogene serine/threonine-protein kinase isoform X1
12	61622.XP_010382540.1	0.601	Cell surface proteoglycan
13	61622.XP_010352886.1	0.583	Nucleolin
14	61622.XP_010370912.1	0.583	Nucleolin-like
15	61622.XP_010353709.1	0.574	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 871 ESTs, 8 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
16	61622.XP_010366985.1	0.572	Belongs to the integrin alpha chain family.
17	61622.XP_010351732.1	0.564	Cell surface proteoglycan
18	61622.XP_010375889.1	0.550	Belongs to the integrin alpha chain family.
19	61622.XP_010351107.1	0.549	RRAD and GEM like GTPase 1
20	61622.XP_010352136.1	0.549	GTPase HRas isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008201	1.000	heparin binding
GO:0005102	0.909	signaling receptor binding
GO:0098772	0.902	molecular function regulator activity
GO:0043177	0.872	organic acid binding
GO:0043167	0.864	ion binding
GO:0140677	0.852	molecular function activator activity
GO:0043168	0.845	anion binding
GO:0031406	0.839	carboxylic acid binding
GO:0008083	0.547	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048522	0.993	positive regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0032502	0.985	developmental process
GO:0032501	0.983	multicellular organismal process
GO:0048856	0.983	anatomical structure development
GO:0040012	0.983	regulation of locomotion
GO:0002682	0.981	regulation of immune system process
GO:0050793	0.979	regulation of developmental process
GO:0051716	0.978	cellular response to stimulus
GO:0048583	0.977	regulation of response to stimulus
GO:0051239	0.970	regulation of multicellular organismal process
GO:0030334	0.969	regulation of cell migration
GO:0048519	0.964	negative regulation of biological process
GO:0016477	0.961	cell migration
GO:0042127	0.961	regulation of cell population proliferation
GO:0002685	0.959	regulation of leukocyte migration
GO:0030155	0.958	regulation of cell adhesion
GO:0030335	0.958	positive regulation of cell migration
GO:0032101	0.955	regulation of response to external stimulus
GO:0007275	0.954	multicellular organism development
GO:0002688	0.952	regulation of leukocyte chemotaxis
GO:0060284	0.951	regulation of cell development
GO:0002687	0.951	positive regulation of leukocyte migration
GO:0048523	0.949	negative regulation of cellular process
GO:0045597	0.943	positive regulation of cell differentiation
GO:2000026	0.942	regulation of multicellular organismal development
GO:0030595	0.942	leukocyte chemotaxis
GO:0002690	0.942	positive regulation of leukocyte chemotaxis
GO:0071622	0.933	regulation of granulocyte chemotaxis
GO:0045785	0.930	positive regulation of cell adhesion
GO:0051241	0.918	negative regulation of multicellular organismal process
GO:0050865	0.918	regulation of cell activation
GO:0008284	0.911	positive regulation of cell population proliferation
GO:0006950	0.901	response to stress
GO:1905521	0.898	regulation of macrophage migration
GO:0010720	0.894	positive regulation of cell development
GO:0048731	0.886	system development
GO:0019222	0.874	regulation of metabolic process
GO:0051240	0.873	positive regulation of multicellular organismal process
GO:0050727	0.869	regulation of inflammatory response
GO:1903706	0.864	regulation of hemopoiesis
GO:0006954	0.862	inflammatory response
GO:0042981	0.861	regulation of apoptotic process
GO:0050678	0.849	regulation of epithelial cell proliferation
GO:0071675	0.848	regulation of mononuclear cell migration
GO:0002694	0.841	regulation of leukocyte activation
GO:0050679	0.841	positive regulation of epithelial cell proliferation
GO:0060255	0.839	regulation of macromolecule metabolic process
GO:1902105	0.832	regulation of leukocyte differentiation
GO:0051249	0.827	regulation of lymphocyte activation
GO:0002523	0.827	leukocyte migration involved in inflammatory response
GO:0043066	0.801	negative regulation of apoptotic process
GO:0023052	0.791	signaling
GO:0007154	0.786	cell communication
GO:0010468	0.786	regulation of gene expression
GO:0045619	0.782	regulation of lymphocyte differentiation
GO:0022603	0.775	regulation of anatomical structure morphogenesis
GO:0007165	0.769	signal transduction
GO:0009893	0.768	positive regulation of metabolic process
GO:0010604	0.763	positive regulation of macromolecule metabolic process
GO:0007399	0.756	nervous system development
GO:0051130	0.752	positive regulation of cellular component organization
GO:0030154	0.751	cell differentiation
GO:0022407	0.726	regulation of cell-cell adhesion
GO:0009719	0.720	response to endogenous stimulus
GO:0031323	0.702	regulation of cellular metabolic process
GO:1903037	0.659	regulation of leukocyte cell-cell adhesion
GO:0007162	0.652	negative regulation of cell adhesion
GO:0023051	0.640	regulation of signaling
GO:0010646	0.640	regulation of cell communication
GO:0050863	0.617	regulation of T cell activation
GO:0048513	0.602	animal organ development
GO:1901342	0.593	regulation of vasculature development
GO:0051171	0.590	regulation of nitrogen compound metabolic process
GO:0009611	0.582	response to wounding
GO:1903039	0.577	positive regulation of leukocyte cell-cell adhesion
GO:0009966	0.545	regulation of signal transduction
GO:0010033	0.544	response to organic substance
GO:1901214	0.529	regulation of neuron death
GO:1901215	0.515	negative regulation of neuron death
GO:0080090	0.513	regulation of primary metabolic process
GO:0043523	0.512	regulation of neuron apoptotic process
GO:0050729	0.506	positive regulation of inflammatory response
GO:0045580	0.504	regulation of T cell differentiation
GO:0031325	0.499	positive regulation of cellular metabolic process
GO:0043524	0.499	negative regulation of neuron apoptotic process
GO:0023056	0.496	positive regulation of signaling
GO:0010647	0.495	positive regulation of cell communication
GO:0010667	0.490	negative regulation of cardiac muscle cell apoptotic process
GO:0009653	0.482	anatomical structure morphogenesis
GO:0009889	0.463	regulation of biosynthetic process
GO:0051093	0.450	negative regulation of developmental process
GO:0009967	0.450	positive regulation of signal transduction
GO:0051173	0.440	positive regulation of nitrogen compound metabolic process
GO:0014013	0.409	regulation of gliogenesis
GO:0010556	0.400	regulation of macromolecule biosynthetic process
GO:0050769	0.391	positive regulation of neurogenesis
GO:0009892	0.387	negative regulation of metabolic process
GO:0008152	0.377	metabolic process
GO:0014015	0.374	positive regulation of gliogenesis
GO:0045685	0.373	regulation of glial cell differentiation
GO:0007166	0.370	cell surface receptor signaling pathway
GO:1902531	0.360	regulation of intracellular signal transduction
GO:0048713	0.357	regulation of oligodendrocyte differentiation
GO:0045687	0.357	positive regulation of glial cell differentiation
GO:0048714	0.354	positive regulation of oligodendrocyte differentiation
GO:0031326	0.347	regulation of cellular biosynthetic process
GO:0019219	0.343	regulation of nucleobase-containing compound metabolic process
GO:0009891	0.324	positive regulation of biosynthetic process
GO:0051246	0.316	regulation of protein metabolic process
GO:0071840	0.309	cellular component organization or biogenesis
GO:0031328	0.305	positive regulation of cellular biosynthetic process
GO:0071704	0.304	organic substance metabolic process
GO:0010557	0.303	positive regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0005576	0.992	extracellular region
GO:0005737	0.987	cytoplasm
GO:0005886	0.944	plasma membrane
GO:0043231	0.824	intracellular membrane-bounded organelle
GO:0030312	0.779	external encapsulating structure
GO:0031012	0.751	extracellular matrix
GO:0062023	0.706	collagen-containing extracellular matrix
GO:0070013	0.644	intracellular organelle lumen
GO:0012505	0.326	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]