StarFunc result for job id P21754

User Input

>input (424 residues)
MELSYRLFICLLLWGSTELCYPQPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLF
GTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDP
RPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEEN
WNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCL
VDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKAC
SFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADV
TVGPLIFLDRRGDHEVEQWALPSDTSVVLLGVGLAVVVSLTLTAVILVLTRRCRTASHPV
SASE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21754	1.000	1.000	1.201E-77	424	1.000	1.000	P21754.pdb.gz	ZP3_HUMAN Zona pellucida sperm-binding protein 3 OS=Homo sapiens OX=9606 GN=ZP3 PE=1 SV=2
2	AFDB:P48831	0.477	0.475	2.348E-59	426	0.708	0.704	P48831.pdb.gz	ZP3_CANLF Zona pellucida sperm-binding protein 3 OS=Canis lupus familiaris OX=9615 GN=ZP3 PE=2 SV=1
3	AFDB:P42098	0.640	0.644	8.611E-59	421	0.677	0.682	P42098.pdb.gz	ZP3_PIG Zona pellucida sperm-binding protein 3 OS=Sus scrofa OX=9823 GN=ZP3 PE=1 SV=1
4	AFDB:P48830	0.603	0.606	1.191E-58	421	0.710	0.715	P48830.pdb.gz	ZP3_BOVIN Zona pellucida sperm-binding protein 3 OS=Bos taurus OX=9913 GN=ZP3 PE=2 SV=1
5	AFDB:P10761	0.686	0.686	2.408E-58	424	0.675	0.675	P10761.pdb.gz	ZP3_MOUSE Zona pellucida sperm-binding protein 3 OS=Mus musculus OX=10090 GN=Zp3 PE=1 SV=4
6	AFDB:P48833	0.452	0.461	2.273E-56	415	0.672	0.687	P48833.pdb.gz	ZP3_RABIT Zona pellucida sperm-binding protein 3 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=ZP3 PE=1 SV=1
7	AFDB:O77685	0.462	0.465	4.744E-44	422	0.441	0.443	O77685.pdb.gz	O77685_TRIVU Zona pellucida sperm-binding protein 3 OS=Trichosurus vulpecula OX=9337 GN=ZP3 PE=2 SV=1
8	AFDB:O73670	0.425	0.412	7.722E-44	437	0.474	0.460	O73670.pdb.gz	O73670_COTJA Zona pellucida sperm-binding protein 3 OS=Coturnix japonica OX=93934 GN=ZPC PE=2 SV=2
9	AFDB:Q5DID3	0.292	0.103	8.411E-17	1319	0.165	0.053	Q5DID3.pdb.gz	UROL1_MOUSE Uromodulin-like 1 OS=Mus musculus OX=10090 GN=Umodl1 PE=1 SV=1
10	AFDB:Q9QZT0	0.283	0.202	3.084E-16	607	0.184	0.129	Q9QZT0.pdb.gz	CUZD1_RAT CUB and zona pellucida-like domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Cuzd1 PE=2 SV=2
11	PDB:4wrnB	0.240	0.159	3.623E-11	663	0.106	0.068	4wrnB.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
12	PDB:3d4gE	0.226	0.204	5.014E-11	472	0.172	0.155	3d4gE.pdb.gz	Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
13	PDB:4wrnA	0.232	0.147	2.162E-10	693	0.104	0.063	4wrnA.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
14	PDB:5hzvA	0.237	0.173	7.702E-9	598	0.083	0.059	5hzvA.pdb.gz	Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
15	PDB:6hd8A	0.164	0.153	1.240E-2	461	0.031	0.028	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
16	PDB:1q90A	0.144	0.194	1.309E-2	292	0.059	0.086	1q90A.pdb.gz	An Atypical Haem in the Cytochrome B6F Complex
17	PDB:2r51A	0.112	0.153	3.112E-2	288	0.083	0.122	2r51A.pdb.gz
18	PDB:5c6wJ	0.153	0.246	3.468E-2	238	0.066	0.118	5c6wJ.pdb.gz
19	PDB:5ir3A	0.168	0.490	3.865E-2	111	0.031	0.117	5ir3A.pdb.gz
20	PDB:2cd0A	0.169	0.502	5.646E-2	111	0.035	0.135	2cd0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10761	0.0	564	424	0.651	0.651	ZP3_MOUSE Zona pellucida sperm-binding protein 3 OS=Mus musculus OX=10090 GN=Zp3 PE=1 SV=4
2	P21754	0.0	876	424	1.000	1.000	ZP3_HUMAN Zona pellucida sperm-binding protein 3 OS=Homo sapiens OX=9606 GN=ZP3 PE=1 SV=2
3	P42098	0.0	617	421	0.729	0.734	ZP3_PIG Zona pellucida sperm-binding protein 3 OS=Sus scrofa OX=9823 GN=ZP3 PE=1 SV=1
4	P48830	0.0	596	421	0.700	0.705	ZP3_BOVIN Zona pellucida sperm-binding protein 3 OS=Bos taurus OX=9913 GN=ZP3 PE=2 SV=1
5	P48831	0.0	611	426	0.703	0.700	ZP3_CANLF Zona pellucida sperm-binding protein 3 OS=Canis lupus familiaris OX=9615 GN=ZP3 PE=2 SV=1
6	P48833	0.0	585	415	0.675	0.689	ZP3_RABIT Zona pellucida sperm-binding protein 3 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=ZP3 PE=1 SV=1
7	P79762	3.46e-125	371	437	0.432	0.419	ZP3_CHICK Zona pellucida sperm-binding protein 3 OS=Gallus gallus OX=9031 GN=ZP3 PE=1 SV=4
8	O73670	1.25e-121	362	437	0.429	0.416	O73670_COTJA Zona pellucida sperm-binding protein 3 OS=Coturnix japonica OX=93934 GN=ZPC PE=2 SV=2
9	O77685	7.39e-116	347	422	0.446	0.448	O77685_TRIVU Zona pellucida sperm-binding protein 3 OS=Trichosurus vulpecula OX=9337 GN=ZP3 PE=2 SV=1
10	Q6PJE2	4.25e-73	229	187	0.250	0.567	POZP3_HUMAN POM121 and ZP3 fusion protein OS=Homo sapiens OX=9606 GN=POMZP3 PE=2 SV=4
11	C9J370	7.75e-41	147	250	0.163	0.276	C9J370_HUMAN POM121 and ZP3 fusion (Fragment) OS=Homo sapiens OX=9606 GN=POMZP3 PE=4 SV=1
12	E5FYG5	7.61e-32	117	66	0.127	0.818	E5FYG5_CAPHI Zona pellucida glycoprotein 3 (Fragment) OS=Capra hircus OX=9925 GN=ZP3 PE=4 SV=1
13	P70412	1.27e-09	62.4	607	0.149	0.104	CUZD1_MOUSE CUB and zona pellucida-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Cuzd1 PE=1 SV=3
14	Q9QZT0	4.97e-09	60.5	607	0.163	0.114	CUZD1_RAT CUB and zona pellucida-like domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Cuzd1 PE=2 SV=2
15	Q8CIZ5	1.60e-08	59.3	1418	0.134	0.040	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
16	Q60997	1.13e-07	56.6	2085	0.137	0.028	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
17	Q6V0K7	5.88e-06	50.8	546	0.156	0.121	OIT3_RAT Oncoprotein-induced transcript 3 protein OS=Rattus norvegicus OX=10116 GN=Oit3 PE=2 SV=1
18	Q8WWZ8	6.76e-06	50.4	545	0.153	0.119	OIT3_HUMAN Oncoprotein-induced transcript 3 protein OS=Homo sapiens OX=9606 GN=OIT3 PE=1 SV=2
19	Q05996	9.61e-06	50.4	745	0.116	0.066	ZP2_HUMAN Zona pellucida sperm-binding protein 2 OS=Homo sapiens OX=9606 GN=ZP2 PE=1 SV=1
20	Q86UP6	2.82e-05	48.9	607	0.149	0.104	CUZD1_HUMAN CUB and zona pellucida-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CUZD1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07398 MDMPI_C	2e+02	14.3	MDMPI C-terminal domain
2	PF00100 Zona_pellucida	2.3e-46	170.2	Zona pellucida-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378326

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482304	0.998	Zona pellucida sperm-binding protein 4
2	9606.ENSP00000278853	0.986	Zona pellucida sperm-binding protein 1
3	9606.ENSP00000460971	0.941	Zona pellucida sperm-binding protein 2
4	9606.ENSP00000253255	0.909	Polycystic kidney disease and receptor for egg jelly-related protein
5	9606.ENSP00000369055	0.863	Beta-1,4-galactosyltransferase 1
6	9606.ENSP00000367942	0.851	Growth/differentiation factor 9
7	9606.ENSP00000358747	0.840	Oviduct-specific glycoprotein
8	9606.ENSP00000352173	0.826	Placenta-specific protein 1
9	9606.ENSP00000333097	0.823	Factor in the germline alpha
10	9606.ENSP00000265708	0.802	Disintegrin and metalloproteinase domain-containing protein 2
11	9606.ENSP00000419457	0.786	Homeobox protein NOBOX
12	9606.ENSP00000345849	0.777	Hyaluronidase PH-20
13	9606.ENSP00000327786	0.774	Izumo sperm-egg fusion protein 1
14	9606.ENSP00000216139	0.768	Acrosin
15	9606.ENSP00000007699	0.750	Y-box-binding protein 2
16	9606.ENSP00000250863	0.746	Deleted in azoospermia-like
17	9606.ENSP00000389445	0.728	Ubiquitin-associated protein 2-like
18	9606.ENSP00000417898	0.703	Glycodelin
19	9606.ENSP00000329803	0.699	Zygote arrest protein 1
20	9606.ENSP00000252677	0.695	Bone morphogenetic protein 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	1.000	extracellular matrix structural constituent
GO:0042802	0.862	identical protein binding
GO:0019899	0.767	enzyme binding
GO:0030246	0.494	carbohydrate binding
GO:0005102	0.337	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.993	biological regulation
GO:0007339	0.990	binding of sperm to zona pellucida
GO:0050789	0.974	regulation of biological process
GO:0050794	0.899	regulation of cellular process
GO:2000241	0.890	regulation of reproductive process
GO:0048518	0.825	positive regulation of biological process
GO:0048522	0.771	positive regulation of cellular process
GO:0048583	0.674	regulation of response to stimulus
GO:2000243	0.623	positive regulation of reproductive process
GO:0050776	0.545	regulation of immune response
GO:0002684	0.518	positive regulation of immune system process
GO:0050778	0.508	positive regulation of immune response
GO:0032501	0.411	multicellular organismal process
GO:0050896	0.341	response to stimulus
GO:0048519	0.313	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.998	cell periphery
GO:0005576	0.949	extracellular region
GO:0031012	0.896	extracellular matrix
GO:0062023	0.884	collagen-containing extracellular matrix
GO:0005615	0.776	extracellular space
GO:0016020	0.553	membrane
GO:0005886	0.446	plasma membrane
GO:0032991	0.395	protein-containing complex
GO:0005622	0.378	intracellular anatomical structure
GO:0043231	0.368	intracellular membrane-bounded organelle
GO:0005737	0.341	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]