StarFunc result for job id P21781

User Input

>input (194 residues)
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
KEQKTAHFLPMAIT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21781	1.000	1.000	4.704E-37	194	1.000	1.000	P21781.pdb.gz	FGF7_HUMAN Fibroblast growth factor 7 OS=Homo sapiens OX=9606 GN=FGF7 PE=1 SV=1
2	AFDB:P70492	0.677	0.612	7.755E-21	215	0.412	0.372	P70492.pdb.gz	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
3	AFDB:Q9ESS2	0.680	0.813	1.796E-20	162	0.356	0.426	Q9ESS2.pdb.gz	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
4	AFDB:O42407	0.684	0.627	2.657E-20	212	0.387	0.354	O42407.pdb.gz	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
5	AFDB:Q1XG76	0.677	0.635	2.810E-20	207	0.407	0.382	Q1XG76.pdb.gz	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
6	AFDB:Q9HCT0	0.679	0.774	4.651E-20	170	0.356	0.406	Q9HCT0.pdb.gz	FGF22_HUMAN Fibroblast growth factor 22 OS=Homo sapiens OX=9606 GN=FGF22 PE=1 SV=1
7	AFDB:Q4VBV7	0.676	0.652	2.109E-19	201	0.356	0.343	Q4VBV7.pdb.gz
8	AFDB:A0A0R4ITI2	0.688	0.698	4.366E-19	191	0.381	0.387	A0A0R4ITI2.pdb.gz
9	AFDB:Q2HXK8	0.670	0.641	1.845E-16	203	0.314	0.300	Q2HXK8.pdb.gz	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
10	AFDB:A6P7H6	0.652	0.520	2.182E-16	245	0.263	0.208	A6P7H6.pdb.gz	FGF13_XENLA Fibroblast growth factor 13 OS=Xenopus laevis OX=8355 GN=fgf13 PE=2 SV=1
11	PDB:3f1rA	0.651	0.801	9.334E-15	157	0.289	0.357	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
12	PDB:4jq0A	0.636	0.867	1.151E-12	141	0.227	0.312	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
13	PDB:1ry7A	0.628	0.800	5.218E-12	151	0.263	0.338	1ry7A.pdb.gz
14	PDB:4qd2B	0.568	0.747	9.182E-5	143	0.088	0.119	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
15	PDB:6b0tA	0.538	0.226	9.710E-5	487	0.088	0.035	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
16	PDB:7t3qA	0.490	0.055	5.507E-4	2103	0.155	0.014	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:7t3pA	0.484	0.056	1.275E-3	2066	0.149	0.014	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:3wmuB	0.462	0.573	1.349E-3	153	0.077	0.098	3wmuB.pdb.gz
19	PDB:3malA	0.415	0.443	1.887E-3	181	0.098	0.105	3malA.pdb.gz
20	PDB:4a7zA	0.538	0.135	2.233E-3	881	0.072	0.016	4a7zA.pdb.gz	Crystal Structure of Bifunctional Aldos-2-Ulose Dehydratase/Isomerase from Phanerochaete Chrysosporium with the Reaction Intermediate Ascopyrone M.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21781	6.22e-148	410	194	1.000	1.000	FGF7_HUMAN Fibroblast growth factor 7 OS=Homo sapiens OX=9606 GN=FGF7 PE=1 SV=1
2	P36363	4.66e-132	370	194	0.943	0.943	FGF7_MOUSE Fibroblast growth factor 7 OS=Mus musculus OX=10090 GN=Fgf7 PE=2 SV=1
3	Q02195	3.98e-126	355	194	0.902	0.902	FGF7_RAT Fibroblast growth factor 7 OS=Rattus norvegicus OX=10116 GN=Fgf7 PE=1 SV=1
4	O15520	5.57e-53	170	208	0.402	0.375	FGF10_HUMAN Fibroblast growth factor 10 OS=Homo sapiens OX=9606 GN=FGF10 PE=1 SV=1
5	P70492	6.87e-53	170	215	0.402	0.363	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
6	O35565	9.16e-53	169	209	0.407	0.378	FGF10_MOUSE Fibroblast growth factor 10 OS=Mus musculus OX=10090 GN=Fgf10 PE=2 SV=1
7	Q1XG76	9.36e-51	164	207	0.443	0.415	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
8	O42407	4.23e-50	163	212	0.376	0.344	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
9	Q8AY90	1.27e-45	151	201	0.392	0.378	Q8AY90_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf10 PE=2 SV=1
10	Q9ESS2	5.09e-45	148	162	0.345	0.414	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
11	Q1XG75	1.44e-43	145	187	0.351	0.364	Q1XG75_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf10b PE=2 SV=1
12	Q9HCT0	3.52e-38	131	170	0.351	0.400	FGF22_HUMAN Fibroblast growth factor 22 OS=Homo sapiens OX=9606 GN=FGF22 PE=1 SV=1
13	O43320	7.31e-34	121	207	0.299	0.280	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
14	P36364	9.41e-34	121	208	0.289	0.269	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
15	P54130	9.41e-34	121	208	0.289	0.269	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
16	Q9NP95	9.86e-34	121	211	0.299	0.275	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
17	P31371	1.14e-33	120	208	0.289	0.269	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
18	Q9ESL9	1.53e-33	120	211	0.299	0.275	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
19	Q9EST9	1.54e-33	120	212	0.299	0.274	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
20	Q2LJ24	2.16e-33	120	208	0.289	0.269	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06268 Fascin	57	15.4	Fascin domain
2	PF00167 FGF	6.2e-46	166.9	Fibroblast growth factor
3	PF04572 Gb3_synth	1.4e+02	14.1	Alpha 1,4-glycosyltransferase conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000006880

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001011	0.985	Fibroblast growth factor receptor 2
2	60711.ENSCSAP00000011731	0.924	Fibroblast growth factor receptor 3
3	60711.ENSCSAP00000005196	0.914	Fibroblast growth factor receptor 4
4	60711.ENSCSAP00000011498	0.875	Fibroblast growth factor receptor 1
5	60711.ENSCSAP00000019193	0.856	Fibroblast growth factor binding protein 1
6	60711.ENSCSAP00000001327	0.836	Kinase insert domain receptor (a type III receptor tyrosine kinase)
7	60711.ENSCSAP00000013992	0.830	Fms-related tyrosine kinase 3
8	60711.ENSCSAP00000013989	0.819	Fms-related tyrosine kinase 1
9	60711.ENSCSAP00000001313	0.811	KIT proto-oncogene receptor tyrosine kinase
10	60711.ENSCSAP00000012126	0.793	Receptor protein-tyrosine kinase
11	60711.ENSCSAP00000004321	0.792	Fms-related tyrosine kinase 4
12	60711.ENSCSAP00000007868	0.787	Tyrosine-protein kinase that acts as cell-surface receptor for homodimeric PDGFB and PDGFD and for heterodimers formed by PDGFA and PDGFB, and plays an essential role in the regulation of embryonic development, cell proliferation, survival, differentiation, chemotaxis and migration. Plays an essential role in blood vessel development by promoting proliferation, migration and recruitment of pericytes and smooth muscle cells to endothelial cells.
13	60711.ENSCSAP00000006021	0.786	TEK tyrosine kinase, endothelial
14	60711.ENSCSAP00000015828	0.784	Neurotrophic tyrosine kinase, receptor, type 1
15	60711.ENSCSAP00000001309	0.782	Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chemotaxis. Depending on the context, promotes or inhibits cell proliferation and cell migration. Plays an important role in the differentiation of bone marrow-derived mesenchymal stem cells. Required for normal skeleton development
16	60711.ENSCSAP00000007252	0.760	HRas proto-oncogene, GTPase
17	60711.ENSCSAP00000017100	0.759	Heparan sulfate proteoglycan 2
18	60711.ENSCSAP00000007132	0.742	MET proto-oncogene, receptor tyrosine kinase
19	60711.ENSCSAP00000015327	0.735	Receptor protein-tyrosine kinase
20	60711.ENSCSAP00000002490	0.732	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.999	growth factor activity
GO:0042056	0.913	chemoattractant activity
GO:0005104	0.330	fibroblast growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0042127	0.991	regulation of cell population proliferation
GO:0009987	0.988	cellular process
GO:0048856	0.988	anatomical structure development
GO:0050896	0.986	response to stimulus
GO:0048518	0.985	positive regulation of biological process
GO:0032501	0.984	multicellular organismal process
GO:0019222	0.976	regulation of metabolic process
GO:0008284	0.976	positive regulation of cell population proliferation
GO:0050678	0.975	regulation of epithelial cell proliferation
GO:0023052	0.974	signaling
GO:0007154	0.974	cell communication
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0080090	0.960	regulation of primary metabolic process
GO:0050679	0.954	positive regulation of epithelial cell proliferation
GO:0031323	0.952	regulation of cellular metabolic process
GO:0051716	0.951	cellular response to stimulus
GO:0048513	0.927	animal organ development
GO:0007275	0.908	multicellular organism development
GO:0070848	0.905	response to growth factor
GO:0007169	0.896	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048731	0.886	system development
GO:0071363	0.877	cellular response to growth factor stimulus
GO:0051171	0.862	regulation of nitrogen compound metabolic process
GO:0030335	0.846	positive regulation of cell migration
GO:0009888	0.837	tissue development
GO:0001932	0.830	regulation of protein phosphorylation
GO:0009893	0.818	positive regulation of metabolic process
GO:0051239	0.808	regulation of multicellular organismal process
GO:0045937	0.807	positive regulation of phosphate metabolic process
GO:0010468	0.802	regulation of gene expression
GO:0009653	0.787	anatomical structure morphogenesis
GO:0010604	0.779	positive regulation of macromolecule metabolic process
GO:0042060	0.770	wound healing
GO:0051173	0.756	positive regulation of nitrogen compound metabolic process
GO:0071774	0.739	response to fibroblast growth factor
GO:0048519	0.721	negative regulation of biological process
GO:0044344	0.720	cellular response to fibroblast growth factor stimulus
GO:0042221	0.716	response to chemical
GO:0050793	0.698	regulation of developmental process
GO:0023051	0.696	regulation of signaling
GO:0010646	0.696	regulation of cell communication
GO:0048583	0.680	regulation of response to stimulus
GO:0008543	0.672	fibroblast growth factor receptor signaling pathway
GO:0010837	0.643	regulation of keratinocyte proliferation
GO:0042327	0.641	positive regulation of phosphorylation
GO:0051247	0.622	positive regulation of protein metabolic process
GO:0001934	0.608	positive regulation of protein phosphorylation
GO:0048523	0.602	negative regulation of cellular process
GO:0035295	0.583	tube development
GO:0071704	0.569	organic substance metabolic process
GO:0009966	0.557	regulation of signal transduction
GO:0044238	0.556	primary metabolic process
GO:0008544	0.535	epidermis development
GO:0060429	0.520	epithelium development
GO:0009605	0.486	response to external stimulus
GO:0071840	0.470	cellular component organization or biogenesis
GO:0030324	0.467	lung development
GO:0010556	0.464	regulation of macromolecule biosynthetic process
GO:0031326	0.463	regulation of cellular biosynthetic process
GO:0019219	0.459	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.445	regulation of DNA-templated transcription
GO:0009891	0.442	positive regulation of biosynthetic process
GO:0016043	0.434	cellular component organization
GO:0008283	0.429	cell population proliferation
GO:0031328	0.415	positive regulation of cellular biosynthetic process
GO:0010557	0.409	positive regulation of macromolecule biosynthetic process
GO:0023056	0.407	positive regulation of signaling
GO:0010647	0.407	positive regulation of cell communication
GO:0030154	0.405	cell differentiation
GO:0048584	0.405	positive regulation of response to stimulus
GO:0045935	0.380	positive regulation of nucleobase-containing compound metabolic process
GO:0051179	0.379	localization
GO:0009967	0.376	positive regulation of signal transduction
GO:0006807	0.374	nitrogen compound metabolic process
GO:0044237	0.364	cellular metabolic process
GO:1902531	0.334	regulation of intracellular signal transduction
GO:0051240	0.311	positive regulation of multicellular organismal process
GO:0051254	0.305	positive regulation of RNA metabolic process
GO:0022603	0.304	regulation of anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.929	intracellular anatomical structure
GO:0043226	0.908	organelle
GO:0043227	0.891	membrane-bounded organelle
GO:0043231	0.857	intracellular membrane-bounded organelle
GO:0005737	0.828	cytoplasm
GO:0012505	0.690	endomembrane system
GO:0005615	0.559	extracellular space
GO:0016020	0.366	membrane
GO:0071944	0.346	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]