StarFunc result for job id P21802

User Input

>input (821 residues)
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV
RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYF
MVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI
NHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL
PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDK
LTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM
IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKT
TNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH
RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYS
PSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4JYQ2	0.675	0.689	0.000	802	0.671	0.687	A4JYQ2.pdb.gz
2	AFDB:F1LSG7	0.437	0.427	0.000	841	0.944	0.922	F1LSG7.pdb.gz	F1LSG7_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
3	AFDB:P11362	0.392	0.392	0.000	822	0.716	0.715	P11362.pdb.gz	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
4	AFDB:P22607	0.422	0.429	0.000	806	0.659	0.671	P22607.pdb.gz	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
5	AFDB:Q498D6	0.522	0.534	0.000	800	0.564	0.579	Q498D6.pdb.gz	FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1
6	AFDB:Q8JG38	0.419	0.421	0.000	817	0.770	0.774	Q8JG38.pdb.gz	FGFR2_DANRE Fibroblast growth factor receptor 2 OS=Danio rerio OX=7955 GN=fgfr2 PE=1 SV=1
7	AFDB:Q90413	0.406	0.363	0.000	922	0.605	0.539	Q90413.pdb.gz	FGFR4_DANRE Fibroblast growth factor receptor 4 OS=Danio rerio OX=7955 GN=fgfr4 PE=1 SV=1
8	AFDB:Q90Z00	0.424	0.429	0.000	810	0.666	0.675	Q90Z00.pdb.gz	FGR1A_DANRE Fibroblast growth factor receptor 1-A OS=Danio rerio OX=7955 GN=fgfr1a PE=1 SV=2
9	AFDB:P22455	0.473	0.483	4.353E-103	802	0.564	0.577	P22455.pdb.gz	FGFR4_HUMAN Fibroblast growth factor receptor 4 OS=Homo sapiens OX=9606 GN=FGFR4 PE=1 SV=2
10	AFDB:G1K2P7	0.425	0.454	1.112E-102	766	0.614	0.658	G1K2P7.pdb.gz
11	PDB:1k9aB	0.298	0.547	1.716E-25	441	0.130	0.243	1k9aB.pdb.gz
12	PDB:2h8hA	0.285	0.505	1.581E-23	445	0.132	0.243	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.286	0.415	7.624E-21	555	0.127	0.187	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.291	0.428	8.636E-20	551	0.107	0.160	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:2qkwB	0.281	0.735	5.192E-17	292	0.083	0.233	2qkwB.pdb.gz
16	PDB:6dldD	0.108	0.295	5.487E-17	269	0.071	0.216	6dldD.pdb.gz
17	PDB:1unlA	0.278	0.747	1.064E-16	292	0.077	0.216	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:5u6yA	0.280	0.485	3.580E-16	459	0.078	0.139	5u6yA.pdb.gz
19	PDB:4zhxA	0.277	0.535	3.783E-16	409	0.082	0.164	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:6s73A	0.286	0.811	3.783E-16	269	0.083	0.253	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K210	1009	803	0.630	0.644	A0A0G2K210_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=2
2	A0A8I5Y7R6	1039	782	0.642	0.674	A0A8I5Y7R6_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=3 SV=1
3	F1LN06	1307	726	0.775	0.876	F1LN06_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
4	F1LNW0	1674	840	0.972	0.950	F1LNW0_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
5	F1LRU8	1325	752	0.801	0.875	F1LRU8_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
6	F1LSG7	1563	841	0.943	0.920	F1LSG7_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
7	F1LSN4	1068	801	0.658	0.674	F1LSN4_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=3
8	F8W9L4	801	792	0.501	0.519	F8W9L4_HUMAN Fibroblast growth factor receptor OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
9	P11362	1209	822	0.724	0.723	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
10	P16092	1201	822	0.717	0.717	FGFR1_MOUSE Fibroblast growth factor receptor 1 OS=Mus musculus OX=10090 GN=Fgfr1 PE=1 SV=2
11	P21802	1715	821	1.000	1.000	FGFR2_HUMAN Fibroblast growth factor receptor 2 OS=Homo sapiens OX=9606 GN=FGFR2 PE=1 SV=1
12	P21803	1669	821	0.970	0.970	FGFR2_MOUSE Fibroblast growth factor receptor 2 OS=Mus musculus OX=10090 GN=Fgfr2 PE=1 SV=4
13	P21804	1212	819	0.736	0.737	FGFR1_CHICK Fibroblast growth factor receptor 1 OS=Gallus gallus OX=9031 GN=FGFR1 PE=2 SV=1
14	P22455	878	802	0.568	0.581	FGFR4_HUMAN Fibroblast growth factor receptor 4 OS=Homo sapiens OX=9606 GN=FGFR4 PE=1 SV=2
15	P22607	1048	806	0.647	0.659	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
16	Q03142	880	799	0.565	0.581	FGFR4_MOUSE Fibroblast growth factor receptor 4 OS=Mus musculus OX=10090 GN=Fgfr4 PE=1 SV=3
17	Q04589	1192	822	0.714	0.713	FGFR1_RAT Fibroblast growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Fgfr1 PE=1 SV=1
18	Q498D6	886	800	0.568	0.583	FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1
19	Q61851	1056	801	0.665	0.682	FGFR3_MOUSE Fibroblast growth factor receptor 3 OS=Mus musculus OX=10090 GN=Fgfr3 PE=1 SV=1
20	Q63236	750	446	0.457	0.841	Q63236_RAT Heparin-binding fibroblast growth factor receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.6	19.3	ABC1 atypical kinase-like domain
2	PF08205 C2-set_2	31	16.0	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	2.7e-32	122.0	Immunoglobulin I-set domain
4	PF00047 ig	1.3e-20	84.7	Immunoglobulin domain
5	PF13895 Ig_2	6.3e-22	89.0	Immunoglobulin domain
6	PF13927 Ig_3	1.8e-32	123.0	Immunoglobulin domain
7	PF16680 Ig_4	26	16.8	T-cell surface glycoprotein CD3 delta chain
8	PF16681 Ig_5	0.0029	29.3	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
9	PF16706 Izumo-Ig	1.2e+02	14.0	Izumo-like Immunoglobulin domain
10	PF14531 Kinase-like	1.9e+02	12.8	Kinase-like
11	PF00069 Pkinase	1.2e-41	154.4	Protein kinase domain
12	PF17667 Pkinase_fungal	6.2e+02	10.5	Fungal protein kinase
13	PF07714 PK_Tyr_Ser-Thr	2.1e-101	350.1	Protein tyrosine and serine/threonine kinase
14	PF07686 V-set	5.4e-12	57.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000001011

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000008567	0.998	Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrins. Its binding to integrins and subsequent ternary complex formation with integrins and FGFR1 are essential for [...]
2	60711.ENSCSAP00000000029	0.997	Fibroblast growth factor 2 (basic)
3	60711.ENSCSAP00000010095	0.996	Phospholipase C, gamma 1
4	60711.ENSCSAP00000012799	0.995	Fibroblast growth factor 10
5	60711.ENSCSAP00000001067	0.993	Growth factor receptor-bound protein 2
6	60711.ENSCSAP00000001820	0.986	Fibroblast growth factor 8 (androgen-induced)
7	60711.ENSCSAP00000006880	0.985	Fibroblast growth factor 7
8	60711.ENSCSAP00000005550	0.975	Fibroblast growth factor 4
9	60711.ENSCSAP00000007252	0.971	HRas proto-oncogene, GTPase
10	60711.ENSCSAP00000004025	0.969	KRAS proto-oncogene, GTPase
11	60711.ENSCSAP00000007334	0.966	Fibroblast growth factor 23
12	60711.ENSCSAP00000016369	0.958	NRAS proto-oncogene, GTPase
13	60711.ENSCSAP00000014599	0.956	GRB2-associated binding protein 1
14	60711.ENSCSAP00000000568	0.955	Fibroblast growth factor receptor substrate 2
15	60711.ENSCSAP00000011731	0.954	Fibroblast growth factor receptor 3
16	60711.ENSCSAP00000014068	0.954	Fibroblast growth factor 9
17	60711.ENSCSAP00000005196	0.945	Fibroblast growth factor receptor 4
18	60711.ENSCSAP00000005540	0.940	Fibroblast growth factor 19
19	60711.ENSCSAP00000011965	0.940	Phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
20	60711.ENSCSAP00000007029	0.937	Fibroblast growth factor 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017134	1.000	fibroblast growth factor binding
GO:0005007	1.000	fibroblast growth factor receptor activity
GO:0042802	0.675	identical protein binding
GO:0005102	0.319	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048731	0.993	system development
GO:0048513	0.992	animal organ development
GO:0009653	0.992	anatomical structure morphogenesis
GO:0048523	0.992	negative regulation of cellular process
GO:0008284	0.992	positive regulation of cell population proliferation
GO:0009888	0.990	tissue development
GO:0030154	0.989	cell differentiation
GO:0010033	0.985	response to organic substance
GO:0008543	0.985	fibroblast growth factor receptor signaling pathway
GO:0071310	0.983	cellular response to organic substance
GO:0050680	0.982	negative regulation of epithelial cell proliferation
GO:0060348	0.981	bone development
GO:0035265	0.980	organ growth
GO:0048762	0.976	mesenchymal cell differentiation
GO:0048660	0.964	regulation of smooth muscle cell proliferation
GO:0098868	0.957	bone growth
GO:0033993	0.954	response to lipid
GO:0003416	0.943	endochondral bone growth
GO:0048598	0.937	embryonic morphogenesis
GO:0009611	0.936	response to wounding
GO:1901701	0.929	cellular response to oxygen-containing compound
GO:0071704	0.906	organic substance metabolic process
GO:0001837	0.903	epithelial to mesenchymal transition
GO:0048729	0.899	tissue morphogenesis
GO:0044237	0.898	cellular metabolic process
GO:0044238	0.895	primary metabolic process
GO:0071560	0.893	cellular response to transforming growth factor beta stimulus
GO:0048646	0.872	anatomical structure formation involved in morphogenesis
GO:0019222	0.867	regulation of metabolic process
GO:0023051	0.866	regulation of signaling
GO:0010646	0.865	regulation of cell communication
GO:0009966	0.864	regulation of signal transduction
GO:0032526	0.861	response to retinoic acid
GO:0071396	0.858	cellular response to lipid
GO:0042060	0.827	wound healing
GO:0060255	0.810	regulation of macromolecule metabolic process
GO:0009605	0.801	response to external stimulus
GO:0031323	0.798	regulation of cellular metabolic process
GO:0006807	0.796	nitrogen compound metabolic process
GO:0048661	0.781	positive regulation of smooth muscle cell proliferation
GO:0007498	0.774	mesoderm development
GO:0065009	0.768	regulation of molecular function
GO:0043170	0.767	macromolecule metabolic process
GO:0023056	0.764	positive regulation of signaling
GO:0009893	0.753	positive regulation of metabolic process
GO:0051239	0.747	regulation of multicellular organismal process
GO:0048584	0.744	positive regulation of response to stimulus
GO:1901564	0.737	organonitrogen compound metabolic process
GO:0050793	0.714	regulation of developmental process
GO:0010647	0.706	positive regulation of cell communication
GO:0036211	0.699	protein modification process
GO:1902531	0.697	regulation of intracellular signal transduction
GO:0051171	0.685	regulation of nitrogen compound metabolic process
GO:0080090	0.684	regulation of primary metabolic process
GO:0010604	0.679	positive regulation of macromolecule metabolic process
GO:0031325	0.679	positive regulation of cellular metabolic process
GO:0044419	0.670	biological process involved in interspecies interaction between organisms
GO:0071300	0.632	cellular response to retinoic acid
GO:0006796	0.626	phosphate-containing compound metabolic process
GO:0009967	0.625	positive regulation of signal transduction
GO:0051173	0.619	positive regulation of nitrogen compound metabolic process
GO:0032496	0.612	response to lipopolysaccharide
GO:0045471	0.584	response to ethanol
GO:0006468	0.581	protein phosphorylation
GO:0001707	0.572	mesoderm formation
GO:0048333	0.558	mesodermal cell differentiation
GO:0043408	0.551	regulation of MAPK cascade
GO:0043410	0.506	positive regulation of MAPK cascade
GO:0071840	0.500	cellular component organization or biogenesis
GO:0051246	0.494	regulation of protein metabolic process
GO:2000026	0.481	regulation of multicellular organismal development
GO:0035556	0.479	intracellular signal transduction
GO:0016043	0.470	cellular component organization
GO:0051174	0.469	regulation of phosphorus metabolic process
GO:0007399	0.467	nervous system development
GO:0031399	0.465	regulation of protein modification process
GO:0001932	0.461	regulation of protein phosphorylation
GO:0051240	0.450	positive regulation of multicellular organismal process
GO:0045595	0.448	regulation of cell differentiation
GO:0043085	0.439	positive regulation of catalytic activity
GO:0051247	0.436	positive regulation of protein metabolic process
GO:0010468	0.423	regulation of gene expression
GO:0042327	0.401	positive regulation of phosphorylation
GO:0001934	0.378	positive regulation of protein phosphorylation
GO:0048468	0.372	cell development
GO:0009889	0.364	regulation of biosynthetic process
GO:0022008	0.352	neurogenesis
GO:2000145	0.328	regulation of cell motility
GO:0031326	0.307	regulation of cellular biosynthetic process
GO:0048699	0.307	generation of neurons
GO:0065008	0.306	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0009986	0.898	cell surface
GO:0005634	0.886	nucleus
GO:0071944	0.613	cell periphery
GO:0016020	0.341	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]