StarFunc result for job id P21817

User Input

>input (1400 residues)
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCL
TTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVYYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGQYLALTEDQGLVV
VDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSF
SGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPSEDLQHEEKQSKLRSLRNRQSLFQEE
GMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYSK
WYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVG
PSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMM
SNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRL
VPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGR
PWQPGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGH
LNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAED
EARAAEPDPDYENLRRSAGGWSEAENGKEGTAKEGAPGGTPQAGGEAQPARAENEKDATT
EKNKKRGFLFKAKKVAMMTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3j8hA	0.785	0.308	0.000	3660	0.795	0.304	3j8hA.pdb.gz	Structure of the rabbit ryanodine receptor RyR1 at near-atomic resolution.
2	PDB:5gkyA	0.785	0.307	0.000	3660	0.790	0.302	5gkyA.pdb.gz	The Central domain of RyR1 is the transducer for long-range allosteric gating of channel opening
3	PDB:5t15B	0.842	0.289	0.000	4170	0.846	0.284	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
4	PDB:6wotA	0.846	0.288	0.000	4197	0.850	0.284	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
5	PDB:6wouA	0.801	0.297	0.000	3921	0.611	0.218	6wouA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
6	PDB:7cf9A	0.835	0.302	0.000	3949	0.839	0.297	7cf9A.pdb.gz	Structural basis for diamide modulation of ryanodine receptor.
7	PDB:7m6aA	0.880	0.291	0.000	4306	0.884	0.288	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
8	PDB:7t65A	0.872	0.292	0.000	4252	0.874	0.288	7t65A.pdb.gz	Molecular mechanism of the severe MH/CCD mutation Y522S in skeletal ryanodine receptor (RyR1) by cryo-EM.
9	PDB:7tdgA	0.829	0.288	0.000	4134	0.846	0.286	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.
10	PDB:7tzcA	0.886	0.286	0.000	4404	0.886	0.282	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
11	AFDB:Q8IVF5	0.054	0.047	2.779E-4	1701	0.134	0.111	Q8IVF5.pdb.gz	TIAM2_HUMAN Rho guanine nucleotide exchange factor TIAM2 OS=Homo sapiens OX=9606 GN=TIAM2 PE=2 SV=4
12	AFDB:I2HAJ6	0.072	0.062	4.178E-4	1725	0.064	0.052	I2HAJ6.pdb.gz	I2HAJ6_CAEEL Neurexin-3-beta OS=Caenorhabditis elegans OX=6239 GN=nrx-1 PE=4 SV=1
13	AFDB:O95490	0.046	0.045	9.096E-3	1459	0.109	0.105	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
14	AFDB:F6P980	0.047	0.050	5.088E-2	1241	0.105	0.118	F6P980.pdb.gz
15	AFDB:Q385F2	0.053	0.057	5.088E-2	1231	0.059	0.067	Q385F2.pdb.gz	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1
16	AFDB:Q8NFW1	0.046	0.042	5.828E-2	1626	0.036	0.031	Q8NFW1.pdb.gz	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
17	AFDB:A0A2Q2SV78	0.123	0.149	8.374E-2	1135	0.021	0.026	A0A2Q2SV78.pdb.gz	A0A2Q2SV78_HUMAN APC regulator of WNT signaling pathway (Fragment) OS=Homo sapiens OX=9606 GN=APC PE=1 SV=1
18	AFDB:E9Q7P1	0.048	0.044	8.763E-2	1613	0.036	0.031	E9Q7P1.pdb.gz	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
19	AFDB:Q584E7	0.063	0.062	9.169E-2	1467	0.110	0.105	Q584E7.pdb.gz	Q584E7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.750 PE=4 SV=1
20	AFDB:Q20712	0.119	0.223	1.317E-1	689	0.022	0.045	Q20712.pdb.gz	Q20712_CAEEL CLASP_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53B3.3 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060WZC7	0.0	1794	4791	0.619	0.181	A0A060WZC7_ONCMY Skeletal muscle ryanodine receptor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00004066001 PE=4 SV=1
2	A2AGL3	0.0	1879	4863	0.648	0.187	RYR3_MOUSE Ryanodine receptor 3 OS=Mus musculus OX=10090 GN=Ryr3 PE=1 SV=1
3	A6P4B8	0.0	2151	5076	0.758	0.209	A6P4B8_DANRE Ryanodine receptor 1 OS=Danio rerio OX=7955 GN=si:dkey-250i19.1 PE=1 SV=1
4	B0LPN4	0.0	1920	4953	0.652	0.184	RYR2_RAT Ryanodine receptor 2 OS=Rattus norvegicus OX=10116 GN=Ryr2 PE=1 SV=2
5	B7WN66	0.0	1159	5085	0.421	0.116	B7WN66_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=5
6	E9PZQ0	0.0	2831	5035	0.964	0.268	RYR1_MOUSE Ryanodine receptor 1 OS=Mus musculus OX=10090 GN=Ryr1 PE=1 SV=1
7	E9Q401	0.0	1914	4966	0.651	0.183	RYR2_MOUSE Ryanodine receptor 2 OS=Mus musculus OX=10090 GN=Ryr2 PE=1 SV=1
8	F1LMY4	0.0	2748	5035	0.955	0.266	RYR1_RAT Ryanodine receptor 1 OS=Rattus norvegicus OX=10116 GN=Ryr1 PE=1 SV=1
9	G1U7D3	0.0	2098	4598	0.728	0.222	G1U7D3_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=4 SV=2
10	I2HAA6	0.0	1159	5187	0.421	0.114	I2HAA6_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
11	I2HAA7	0.0	1159	5071	0.421	0.116	I2HAA7_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
12	P11716	0.0	2833	5037	0.966	0.269	RYR1_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=1 SV=1
13	P21817	0.0	2929	5038	1.000	0.278	RYR1_HUMAN Ryanodine receptor 1 OS=Homo sapiens OX=9606 GN=RYR1 PE=1 SV=3
14	P30957	0.0	1924	4969	0.656	0.185	RYR2_RABIT Ryanodine receptor 2 OS=Oryctolagus cuniculus OX=9986 GN=RYR2 PE=1 SV=3
15	Q15413	0.0	1872	4870	0.643	0.185	RYR3_HUMAN Ryanodine receptor 3 OS=Homo sapiens OX=9606 GN=RYR3 PE=1 SV=3
16	Q24498	0.0	1265	5127	0.475	0.130	RYR_DROME Ryanodine receptor OS=Drosophila melanogaster OX=7227 GN=RyR PE=1 SV=3
17	Q92736	0.0	1929	4967	0.657	0.185	RYR2_HUMAN Ryanodine receptor 2 OS=Homo sapiens OX=9606 GN=RYR2 PE=1 SV=3
18	Q94279	0.0	1159	5201	0.421	0.113	Q94279_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=6
19	Q9TS33	0.0	1821	4872	0.632	0.182	RYR3_RABIT Ryanodine receptor 3 OS=Oryctolagus cuniculus OX=9986 GN=RYR3 PE=1 SV=1
20	P29995	6.57e-22	106	2701	0.102	0.053	ITPR2_RAT Inositol 1,4,5-trisphosphate receptor type 2 OS=Rattus norvegicus OX=10116 GN=Itpr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08709 Ins145_P3_rec	1.6e-62	222.0	Inositol 1,4,5-trisphosphate/ryanodine receptor
2	PF02815 MIR	6.2e-53	190.9	MIR domain
3	PF01365 RYDR_ITPR	7.4e-65	229.8	RIH domain
4	PF02026 RyR	1.7e-60	212.6	RyR domain
5	PF00622 SPRY	1.9e-39	145.9	SPRY domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352608

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383003	0.999	Peptidyl-prolyl cis-trans isomerase FKBP1A
2	9606.ENSP00000355192	0.998	Voltage-dependent L-type calcium channel subunit alpha-1S
3	9606.ENSP00000439281	0.998	Triadin
4	9606.ENSP00000370373	0.996	Peptidyl-prolyl cis-trans isomerase FKBP1B
5	9606.ENSP00000292169	0.993	Protein S100-A1
6	9606.ENSP00000349467	0.993	Calmodulin-1
7	9606.ENSP00000281243	0.989	Dihydropteridine reductase
8	9606.ENSP00000368767	0.974	Aspartyl/asparaginyl beta-hydroxylase
9	9606.ENSP00000272298	0.969	Calmodulin 2 (phosphorylase kinase, delta)
10	9606.ENSP00000344488	0.968	Junctophilin-1
11	9606.ENSP00000329200	0.958	SH3 and cysteine-rich domain-containing protein 3
12	9606.ENSP00000266376	0.955	Voltage-dependent L-type calcium channel subunit alpha-1C
13	9606.ENSP00000355533	0.955	Ryanodine receptor 2
14	9606.ENSP00000291295	0.949	Calmodulin 3 (phosphorylase kinase, delta)
15	9606.ENSP00000373884	0.941	Ryanodine receptor 3
16	9606.ENSP00000349595	0.928	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
17	9606.ENSP00000357057	0.916	Calsequestrin-1
18	9606.ENSP00000349320	0.905	Voltage-dependent calcium channel subunit alpha-2/delta-1
19	9606.ENSP00000477999	0.904	Nitric oxide synthase, brain
20	9606.ENSP00000353362	0.902	Voltage-dependent P/Q-type calcium channel subunit alpha-1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0015278	0.999	calcium-release channel activity
GO:0005219	0.988	ryanodine-sensitive calcium-release channel activity
GO:0042802	0.734	identical protein binding
GO:0097159	0.710	organic cyclic compound binding
GO:0015643	0.556	toxic substance binding
GO:0043167	0.528	ion binding
GO:0005516	0.509	calmodulin binding
GO:0019899	0.456	enzyme binding
GO:0043168	0.436	anion binding
GO:0036094	0.430	small molecule binding
GO:0035381	0.312	ATP-gated ion channel activity
GO:0044325	0.301	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0006816	0.971	calcium ion transport
GO:0050789	0.931	regulation of biological process
GO:0070588	0.910	calcium ion transmembrane transport
GO:0050794	0.907	regulation of cellular process
GO:0051283	0.887	negative regulation of sequestering of calcium ion
GO:0097553	0.879	calcium ion transmembrane import into cytosol
GO:0051209	0.873	release of sequestered calcium ion into cytosol
GO:0014074	0.813	response to purine-containing compound
GO:0031000	0.797	response to caffeine
GO:0051716	0.528	cellular response to stimulus
GO:0071312	0.451	cellular response to alkaloid
GO:0071407	0.432	cellular response to organic cyclic compound
GO:0032501	0.393	multicellular organismal process
GO:1901700	0.371	response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016529	0.998	sarcoplasmic reticulum
GO:0016020	0.997	membrane
GO:0098827	0.993	endoplasmic reticulum subcompartment
GO:0005789	0.967	endoplasmic reticulum membrane
GO:0033017	0.958	sarcoplasmic reticulum membrane
GO:0032991	0.897	protein-containing complex
GO:0071944	0.856	cell periphery
GO:0005886	0.829	plasma membrane
GO:0034702	0.412	ion channel complex
GO:1990425	0.378	ryanodine receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.999	Ca(2+)(in) = Ca(2+)(out)

[back to server]