StarFunc result for job id P21860

User Input

>input (1342 residues)
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR
PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY
EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QP50	0.690	0.650	0.000	1429	0.510	0.479	F1QP50.pdb.gz
2	AFDB:P21860	1.000	1.000	0.000	1342	1.000	1.000	P21860.pdb.gz	ERBB3_HUMAN Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens OX=9606 GN=ERBB3 PE=1 SV=1
3	PDB:7mn8B	0.221	0.498	2.024E-62	579	0.193	0.447	7mn8B.pdb.gz
4	PDB:4fl2A	0.186	0.431	2.386E-23	555	0.072	0.175	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
5	PDB:6pxvA	0.160	0.248	6.248E-23	823	0.098	0.159	6pxvA.pdb.gz
6	PDB:2h8hA	0.189	0.553	3.415E-22	445	0.071	0.213	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
7	PDB:8dtlA	0.226	0.384	1.329E-21	741	0.099	0.179	8dtlA.pdb.gz
8	PDB:4k2rA	0.183	0.429	1.488E-21	551	0.069	0.167	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
9	PDB:1k9aB	0.175	0.514	3.480E-21	441	0.069	0.211	1k9aB.pdb.gz
10	AFDB:Q10925	0.184	0.199	5.717E-21	1237	0.122	0.133	Q10925.pdb.gz	SID3_CAEEL Tyrosine-protein kinase sid-3 OS=Caenorhabditis elegans OX=6239 GN=sid-3 PE=1 SV=2
11	AFDB:Q96Q04	0.169	0.156	7.731E-20	1460	0.131	0.121	Q96Q04.pdb.gz	LMTK3_HUMAN Serine/threonine-protein kinase LMTK3 OS=Homo sapiens OX=9606 GN=LMTK3 PE=1 SV=2
12	PDB:7bwaA	0.165	0.310	7.981E-19	674	0.095	0.188	7bwaA.pdb.gz
13	PDB:8eyyA	0.193	0.309	2.773E-18	775	0.087	0.151	8eyyA.pdb.gz
14	PDB:6pyhD	0.158	0.254	1.604E-17	798	0.083	0.140	6pyhD.pdb.gz
15	AFDB:Q8IWU2	0.174	0.156	1.676E-17	1503	0.118	0.105	Q8IWU2.pdb.gz	LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens OX=9606 GN=LMTK2 PE=1 SV=2
16	AFDB:A0A024RD59	0.157	0.311	9.332E-16	632	0.079	0.168	A0A024RD59.pdb.gz
17	AFDB:P51957	0.167	0.259	3.843E-15	841	0.089	0.141	P51957.pdb.gz	NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2
18	AFDB:D3ZDV9	0.176	0.292	6.397E-15	793	0.086	0.146	D3ZDV9.pdb.gz	D3ZDV9_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=4 SV=2
19	AFDB:O08815	0.172	0.190	1.675E-14	1206	0.092	0.102	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
20	AFDB:O54988	0.173	0.187	2.352E-14	1233	0.092	0.101	O54988.pdb.gz	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQB9	913	1170	0.335	0.385	A0A8I5ZQB9_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=1 SV=1
2	A6QR62	2467	1336	0.923	0.927	A6QR62_BOVIN Receptor protein-tyrosine kinase OS=Bos taurus OX=9913 GN=ERBB3 PE=2 SV=1
3	B4DTR1	653	979	0.249	0.341	B4DTR1_HUMAN Erb-b2 receptor tyrosine kinase 2 OS=Homo sapiens OX=9606 GN=ERBB2 PE=1 SV=1
4	B8LFF6	1181	1414	0.418	0.397	B8LFF6_DANRE Receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=erbb4 PE=2 SV=1
5	E7CXR8	986	1209	0.360	0.400	E7CXR8_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=2 SV=1
6	E7CXR9	985	1209	0.359	0.399	E7CXR9_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=2 SV=1
7	F1N7F3	956	1179	0.355	0.404	F1N7F3_BOVIN Receptor protein-tyrosine kinase OS=Bos taurus OX=9913 GN=EGFR PE=3 SV=3
8	G3V6K6	980	1208	0.359	0.399	G3V6K6_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=1 SV=2
9	J3QLU9	900	1055	0.346	0.441	J3QLU9_HUMAN Receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=ERBB2 PE=1 SV=1
10	P00533	960	1210	0.351	0.389	EGFR_HUMAN Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=2
11	P04626	900	1255	0.346	0.371	ERBB2_HUMAN Receptor tyrosine-protein kinase erbB-2 OS=Homo sapiens OX=9606 GN=ERBB2 PE=1 SV=1
12	P06494	892	1257	0.348	0.372	ERBB2_RAT Receptor tyrosine-protein kinase erbB-2 OS=Rattus norvegicus OX=10116 GN=Erbb2 PE=1 SV=3
13	P21860	2783	1342	1.000	1.000	ERBB3_HUMAN Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens OX=9606 GN=ERBB3 PE=1 SV=1
14	P70424	889	1256	0.345	0.369	ERBB2_MOUSE Receptor tyrosine-protein kinase erbB-2 OS=Mus musculus OX=10090 GN=Erbb2 PE=1 SV=3
15	Q01279	989	1210	0.361	0.400	EGFR_MOUSE Epidermal growth factor receptor OS=Mus musculus OX=10090 GN=Egfr PE=1 SV=1
16	Q15303	1201	1308	0.446	0.458	ERBB4_HUMAN Receptor tyrosine-protein kinase erbB-4 OS=Homo sapiens OX=9606 GN=ERBB4 PE=1 SV=1
17	Q153D9	1187	1299	0.424	0.438	Q153D9_XENLA Receptor protein-tyrosine kinase OS=Xenopus laevis OX=8355 GN=erbb4.L PE=2 SV=1
18	Q4PLA5	1184	1292	0.434	0.450	Q4PLA5_CHICK Receptor protein-tyrosine kinase OS=Gallus gallus OX=9031 GN=ERBB4 PE=2 SV=1
19	Q504U8	914	1091	0.340	0.418	Q504U8_HUMAN Receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=1
20	Q5EBY4	895	1275	0.345	0.363	Q5EBY4_DANRE Receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=wu:fv70f10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00757 Furin-like	2.7e-33	126.4	Furin-like cysteine rich region
2	PF14843 GF_recep_IV	1.7e-50	181.6	Growth factor receptor domain IV
3	PF14531 Kinase-like	11	16.8	Kinase-like
4	PF00069 Pkinase	2e-29	114.4	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	2.3e-74	261.5	Protein tyrosine and serine/threonine kinase
6	PF01030 Recep_L_domain	4.3e-58	205.6	Receptor L domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267101

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265171	0.999	Pro-epidermal growth factor
2	9606.ENSP00000354910	0.999	Pro-neuregulin-2, membrane-bound isoform
3	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
4	9606.ENSP00000384620	0.999	Pro-neuregulin-1, membrane-bound isoform
5	9606.ENSP00000401303	0.999	SHC-transforming protein 1
6	9606.ENSP00000428056	0.999	Phosphatidylinositol 3-kinase regulatory subunit alpha
7	9606.ENSP00000275493	0.997	Epidermal growth factor receptor
8	9606.ENSP00000302886	0.995	Proliferation-associated protein 2G4
9	9606.ENSP00000342755	0.995	E3 ubiquitin-protein ligase NRDP1
10	9606.ENSP00000269571	0.992	Receptor tyrosine-protein kinase erbB-2
11	9606.ENSP00000222254	0.990	Phosphatidylinositol 3-kinase regulatory subunit beta
12	9606.ENSP00000263967	0.990	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
13	9606.ENSP00000451828	0.988	RAC-alpha serine/threonine-protein kinase
14	9606.ENSP00000403459	0.987	Growth factor receptor-bound protein 7
15	9606.ENSP00000340944	0.985	Tyrosine-protein phosphatase non-receptor type 11
16	9606.ENSP00000407586	0.984	GTPase HRas
17	9606.ENSP00000244869	0.983	Proepiregulin
18	9606.ENSP00000256078	0.983	GTPase KRas
19	9606.ENSP00000379097	0.983	Amphiregulin
20	9606.ENSP00000417498	0.979	Mucin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	0.999	growth factor binding
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0016301	0.995	kinase activity
GO:0004672	0.993	protein kinase activity
GO:0030296	0.992	protein tyrosine kinase activator activity
GO:0005102	0.991	signaling receptor binding
GO:0042802	0.986	identical protein binding
GO:0019899	0.985	enzyme binding
GO:0004713	0.971	protein tyrosine kinase activity
GO:0044389	0.889	ubiquitin-like protein ligase binding
GO:0046982	0.888	protein heterodimerization activity
GO:0031625	0.883	ubiquitin protein ligase binding
GO:0004714	0.673	transmembrane receptor protein tyrosine kinase activity
GO:0038132	0.578	neuregulin binding
GO:0019900	0.565	kinase binding
GO:0043125	0.514	ErbB-3 class receptor binding
GO:0044877	0.356	protein-containing complex binding
GO:0019901	0.341	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.997	response to stimulus
GO:0050794	0.997	regulation of cellular process
GO:0007169	0.988	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0032501	0.976	multicellular organismal process
GO:0048856	0.976	anatomical structure development
GO:0007275	0.970	multicellular organism development
GO:0048731	0.953	system development
GO:0048518	0.940	positive regulation of biological process
GO:0048522	0.926	positive regulation of cellular process
GO:0048869	0.913	cellular developmental process
GO:0038127	0.895	ERBB signaling pathway
GO:0019222	0.888	regulation of metabolic process
GO:0010646	0.885	regulation of cell communication
GO:0060255	0.867	regulation of macromolecule metabolic process
GO:0080090	0.862	regulation of primary metabolic process
GO:0048583	0.857	regulation of response to stimulus
GO:0031323	0.856	regulation of cellular metabolic process
GO:0023051	0.854	regulation of signaling
GO:0051171	0.854	regulation of nitrogen compound metabolic process
GO:0048513	0.850	animal organ development
GO:0048519	0.846	negative regulation of biological process
GO:0009893	0.815	positive regulation of metabolic process
GO:0009966	0.793	regulation of signal transduction
GO:0010604	0.792	positive regulation of macromolecule metabolic process
GO:0048523	0.788	negative regulation of cellular process
GO:0032879	0.740	regulation of localization
GO:0048584	0.710	positive regulation of response to stimulus
GO:0051173	0.709	positive regulation of nitrogen compound metabolic process
GO:0042127	0.705	regulation of cell population proliferation
GO:0030154	0.704	cell differentiation
GO:0031325	0.699	positive regulation of cellular metabolic process
GO:1902531	0.692	regulation of intracellular signal transduction
GO:0065009	0.684	regulation of molecular function
GO:0051246	0.671	regulation of protein metabolic process
GO:0009967	0.667	positive regulation of signal transduction
GO:0051174	0.627	regulation of phosphorus metabolic process
GO:0071704	0.621	organic substance metabolic process
GO:0044237	0.610	cellular metabolic process
GO:0044238	0.609	primary metabolic process
GO:0007399	0.597	nervous system development
GO:0006807	0.595	nitrogen compound metabolic process
GO:0051247	0.563	positive regulation of protein metabolic process
GO:1902533	0.561	positive regulation of intracellular signal transduction
GO:0042325	0.559	regulation of phosphorylation
GO:0043170	0.556	macromolecule metabolic process
GO:0031399	0.550	regulation of protein modification process
GO:0050790	0.542	regulation of catalytic activity
GO:0044093	0.542	positive regulation of molecular function
GO:0001932	0.511	regulation of protein phosphorylation
GO:0035556	0.502	intracellular signal transduction
GO:0001934	0.500	positive regulation of protein phosphorylation
GO:0009653	0.475	anatomical structure morphogenesis
GO:0010941	0.474	regulation of cell death
GO:0042221	0.456	response to chemical
GO:0010468	0.448	regulation of gene expression
GO:0043085	0.437	positive regulation of catalytic activity
GO:0051239	0.435	regulation of multicellular organismal process
GO:0022008	0.434	neurogenesis
GO:0043067	0.425	regulation of programmed cell death
GO:0009888	0.422	tissue development
GO:1901564	0.407	organonitrogen compound metabolic process
GO:0019538	0.401	protein metabolic process
GO:0051049	0.380	regulation of transport
GO:0008284	0.359	positive regulation of cell population proliferation
GO:0060548	0.334	negative regulation of cell death
GO:0071840	0.324	cellular component organization or biogenesis
GO:0009719	0.319	response to endogenous stimulus
GO:0050793	0.318	regulation of developmental process
GO:0009889	0.312	regulation of biosynthetic process
GO:0006796	0.302	phosphate-containing compound metabolic process
GO:0036211	0.302	protein modification process
GO:0010033	0.300	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043227	0.995	membrane-bounded organelle
GO:0032991	0.989	protein-containing complex
GO:0005634	0.989	nucleus
GO:0005737	0.985	cytoplasm
GO:0098590	0.980	plasma membrane region
GO:0030054	0.954	cell junction
GO:0005829	0.709	cytosol
GO:0005576	0.692	extracellular region
GO:0045178	0.567	basal part of cell
GO:0043235	0.563	receptor complex
GO:0005615	0.562	extracellular space
GO:0016323	0.447	basolateral plasma membrane
GO:0038143	0.383	ERBB3:ERBB2 complex
GO:0045202	0.377	synapse
GO:0045177	0.310	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.995	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.994	Phosphotransferases with an alcohol group as acceptor.
RHEA:10596	0.971	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.673	receptor protein-tyrosine kinase.

[back to server]