StarFunc result for job id P21912

User Input

>input (280 residues)
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21913	0.921	0.915	6.120E-50	282	0.911	0.904	P21913.pdb.gz	SDHB_RAT Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sdhb PE=2 SV=2
2	AFDB:P21801	0.846	0.889	1.612E-41	266	0.636	0.669	P21801.pdb.gz	SDHB_YEAST Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDH2 PE=1 SV=1
3	AFDB:P21914	0.868	0.819	1.705E-41	297	0.661	0.623	P21914.pdb.gz	SDHB_DROME Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SdhB PE=2 SV=2
4	PDB:3sfeB	0.847	0.988	1.711E-41	240	0.829	0.967	3sfeB.pdb.gz	Thiabendazole inhibits ubiquinone reduction activity of mitochondrial respiratory complex II via a water molecule mediated binding feature.
5	AFDB:Q59QN7	0.842	0.896	6.893E-41	263	0.643	0.684	Q59QN7.pdb.gz	Q59QN7_CANAL Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SDH2 PE=3 SV=1
6	AFDB:Q2TWM0	0.825	0.831	6.813E-40	278	0.621	0.626	Q2TWM0.pdb.gz	Q2TWM0_ASPOR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090010000505 PE=3 SV=1
7	AFDB:P21911	0.823	0.838	2.463E-39	275	0.596	0.607	P21911.pdb.gz	SDHB_SCHPO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdh2 PE=3 SV=3
8	AFDB:Q09545	0.844	0.794	1.053E-38	298	0.596	0.560	Q09545.pdb.gz	SDHB_CAEEL Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sdhb-1 PE=2 SV=1
9	AFDB:Q9S827	0.824	0.821	5.262E-37	281	0.557	0.555	Q9S827.pdb.gz	SDHB1_ORYSJ Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SDH2-1 PE=1 SV=1
10	AFDB:Q8LB02	0.820	0.820	5.816E-36	280	0.564	0.564	Q8LB02.pdb.gz	SDHB2_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH2-2 PE=1 SV=2
11	AFDB:Q9FJP9	0.833	0.755	1.572E-34	309	0.514	0.466	Q9FJP9.pdb.gz	SDHB3_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH2-3 PE=1 SV=1
12	PDB:2aczB	0.793	0.929	1.818E-27	238	0.454	0.534	2aczB.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
13	PDB:2b76B	0.783	0.899	8.959E-20	243	0.257	0.296	2b76B.pdb.gz	Fumarate Reductase and Succinate Oxidase Activity of Escherichia coli Complex II Homologs Are Perturbed Differently by Mutation of the Flavin Binding Domain
14	PDB:3hrdD	0.216	0.325	3.007E-3	160	0.111	0.194	3hrdD.pdb.gz	The Mo-Se active site of nicotinate dehydrogenase
15	PDB:3ax7A	0.181	0.051	2.101E-1	1225	0.096	0.022	3ax7A.pdb.gz	Protein conformational gating of enzymatic activity in xanthine oxidoreductase
16	PDB:4yknA	0.182	0.054	5.744E-1	1205	0.036	0.008	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
17	PDB:6hiwDU	0.153	0.185	1.004	213	0.054	0.070	6hiwDU.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
18	PDB:2bb6A	0.181	0.129	1.756	414	0.039	0.027	2bb6A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
19	PDB:3jcfA	0.117	0.102	2.077	349	0.082	0.066	3jcfA.pdb.gz
20	PDB:1jkyA	0.082	0.040	2.322	748	0.057	0.021	1jkyA.pdb.gz	Crystal structure of the anthrax lethal factor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21912	0.0	585	280	1.000	1.000	SDHB_HUMAN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHB PE=1 SV=3
2	P21913	0.0	524	282	0.911	0.904	SDHB_RAT Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sdhb PE=2 SV=2
3	Q007T0	0.0	564	280	0.957	0.957	SDHB_PIG Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Sus scrofa OX=9823 GN=SDHB PE=1 SV=1
4	Q9CQA3	0.0	530	282	0.918	0.911	SDHB_MOUSE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdhb PE=1 SV=1
5	P21914	3.89e-148	418	297	0.693	0.653	SDHB_DROME Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SdhB PE=2 SV=2
6	Q59QN7	1.91e-134	382	263	0.639	0.681	Q59QN7_CANAL Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SDH2 PE=3 SV=1
7	P21801	2.65e-131	374	266	0.614	0.647	SDHB_YEAST Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDH2 PE=1 SV=1
8	Q09545	1.48e-128	369	298	0.586	0.550	SDHB_CAEEL Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sdhb-1 PE=2 SV=1
9	Q2TWM0	2.37e-127	365	278	0.586	0.590	Q2TWM0_ASPOR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090010000505 PE=3 SV=1
10	P21911	4.42e-120	346	275	0.593	0.604	SDHB_SCHPO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdh2 PE=3 SV=3
11	Q8LB02	1.05e-114	333	280	0.554	0.554	SDHB2_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH2-2 PE=1 SV=2
12	Q8LBZ7	2.61e-114	332	279	0.564	0.566	SDHB1_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH2-1 PE=1 SV=2
13	Q9S827	2.24e-109	319	281	0.532	0.530	SDHB1_ORYSJ Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SDH2-1 PE=1 SV=1
14	Q9FJP9	2.93e-104	307	309	0.500	0.453	SDHB3_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH2-3 PE=1 SV=1
15	Q6H4G3	1.05e-101	301	311	0.475	0.428	SDHB2_ORYSJ Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SDH2-2 PE=1 SV=1
16	P07014	6.62e-87	261	238	0.464	0.546	SDHB_ECOLI Succinate dehydrogenase iron-sulfur subunit OS=Escherichia coli (strain K12) OX=83333 GN=sdhB PE=1 SV=1
17	O53371	8.34e-51	169	263	0.336	0.357	O53371_MYCTU succinate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sdhB PE=1 SV=1
18	P0AC47	2.01e-31	119	244	0.250	0.287	FRDB_ECOLI Fumarate reductase iron-sulfur subunit OS=Escherichia coli (strain K12) OX=83333 GN=frdB PE=1 SV=2
19	Q38EW9	2.88e-30	114	188	0.189	0.282	Q38EW9_TRYB2 Succinate dehydrogenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4380 PE=4 SV=1
20	Q726C8	1.46e-23	98.2	247	0.257	0.291	Q726C8_DESVH succinate dehydrogenase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=frdB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00111 Fer2	5	18.5	2Fe-2S iron-sulfur cluster binding domain
2	PF13085 Fer2_3	1.2e-30	117.1	2Fe-2S iron-sulfur cluster binding domain
3	PF13237 Fer4_10	0.0018	29.6	4Fe-4S dicluster domain
4	PF13534 Fer4_17	1e-06	40.5	4Fe-4S dicluster domain
5	PF13746 Fer4_18	81	14.8	4Fe-4S dicluster domain
6	PF12838 Fer4_7	91	15.1	4Fe-4S dicluster domain
7	PF13183 Fer4_8	0.00012	33.8	4Fe-4S dicluster domain
8	PF13187 Fer4_9	28	16.3	4Fe-4S dicluster domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364649

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264932	0.999	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
2	9606.ENSP00000356953	0.999	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
3	9606.ENSP00000364699	0.999	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
4	9606.ENSP00000377446	0.999	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
5	9606.ENSP00000233627	0.997	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
6	9606.ENSP00000268379	0.997	Cytochrome b-c1 complex subunit 2, mitochondrial
7	9606.ENSP00000356972	0.995	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
8	9606.ENSP00000355518	0.993	Fumarate hydratase, mitochondrial
9	9606.ENSP00000216027	0.992	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
10	9606.ENSP00000322450	0.992	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
11	9606.ENSP00000362873	0.991	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
12	9606.ENSP00000306397	0.987	Cytochrome b-c1 complex subunit Rieske, mitochondrial
13	9606.ENSP00000367923	0.986	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
14	9606.ENSP00000335304	0.978	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
15	9606.ENSP00000263774	0.974	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
16	9606.ENSP00000266544	0.973	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
17	9606.ENSP00000258424	0.972	Cytochrome c oxidase subunit 5B, mitochondrial
18	9606.ENSP00000301587	0.972	ATP synthase subunit d, mitochondrial
19	9606.ENSP00000315774	0.972	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
20	9606.ENSP00000327268	0.972	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0016491	0.997	oxidoreductase activity
GO:0016627	0.957	oxidoreductase activity, acting on the CH-CH group of donors
GO:0016635	0.951	oxidoreductase activity, acting on the CH-CH group of donors, quinone or related compound as acceptor
GO:0000104	0.949	succinate dehydrogenase activity
GO:0051536	0.856	iron-sulfur cluster binding
GO:0051537	0.760	2 iron, 2 sulfur cluster binding
GO:0008177	0.569	succinate dehydrogenase (ubiquinone) activity
GO:0009055	0.469	electron transfer activity
GO:0051539	0.446	4 iron, 4 sulfur cluster binding
GO:0051538	0.405	3 iron, 4 sulfur cluster binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.973	primary metabolic process
GO:0009060	0.950	aerobic respiration
GO:0006099	0.903	tricarboxylic acid cycle
GO:0071704	0.725	organic substance metabolic process
GO:0044281	0.340	small molecule metabolic process
GO:0022904	0.300	respiratory electron transport chain

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019866	0.999	organelle inner membrane
GO:0032991	0.998	protein-containing complex
GO:0031966	0.997	mitochondrial membrane
GO:0005743	0.994	mitochondrial inner membrane
GO:1902494	0.983	catalytic complex
GO:0070469	0.983	respirasome
GO:0098796	0.977	membrane protein complex
GO:0070013	0.968	intracellular organelle lumen
GO:0098803	0.963	respiratory chain complex
GO:0098798	0.938	mitochondrial protein-containing complex
GO:1990204	0.924	oxidoreductase complex
GO:0098800	0.911	inner mitochondrial membrane protein complex
GO:0045273	0.895	respiratory chain complex II
GO:0005746	0.889	mitochondrial respirasome
GO:0005634	0.838	nucleus
GO:0031981	0.671	nuclear lumen
GO:0045283	0.617	fumarate reductase complex
GO:0045257	0.595	succinate dehydrogenase complex (ubiquinone)
GO:0005654	0.550	nucleoplasm
GO:0005749	0.421	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.997	Oxidoreductases.
EC:1.3.-.-	0.957	Acting on the CH-CH group of donors.
EC:1.3.5.-	0.951	With a quinone or related compound as acceptor.
RHEA:16357	0.949	A + succinate = AH2 + fumarate
RHEA:13713	0.569	a ubiquinone + succinate = a ubiquinol + fumarate
EC:1.3.5.1	0.569	succinate dehydrogenase.

[back to server]