StarFunc result for job id P21918

User Input

>input (477 residues)
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21918	1.000	1.000	9.446E-62	477	1.000	1.000	P21918.pdb.gz	DRD5_HUMAN D(1B) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD5 PE=1 SV=2
2	AFDB:Q8BLD9	0.874	0.872	3.207E-50	478	0.830	0.828	Q8BLD9.pdb.gz	DRD5_MOUSE D(1B) dopamine receptor OS=Mus musculus OX=10090 GN=Drd5 PE=2 SV=1
3	AFDB:H0YPZ4	0.648	0.681	3.991E-35	453	0.549	0.578	H0YPZ4.pdb.gz	H0YPZ4_TAEGU Dopamine receptor D1 OS=Taeniopygia guttata OX=59729 GN=DRD1 PE=3 SV=1
4	AFDB:P18901	0.644	0.686	1.249E-34	446	0.524	0.561	P18901.pdb.gz	DRD1_RAT D(1A) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd1 PE=1 SV=2
5	PDB:7jvqR	0.544	0.881	1.320E-27	286	0.455	0.759	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
6	AFDB:P08588	0.590	0.590	2.985E-23	477	0.327	0.327	P08588.pdb.gz	ADRB1_HUMAN Beta-1 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB1 PE=1 SV=3
7	AFDB:E7EYN4	0.593	0.694	3.259E-23	405	0.296	0.348	E7EYN4.pdb.gz
8	AFDB:B3DHM6	0.601	0.733	4.431E-23	390	0.306	0.374	B3DHM6.pdb.gz	B3DHM6_DANRE Adrenergic, beta-1-, receptor OS=Danio rerio OX=7955 GN=zgc:194728 PE=2 SV=1
9	AFDB:P10608	0.607	0.689	5.054E-23	418	0.279	0.318	P10608.pdb.gz	ADRB2_RAT Beta-2 adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adrb2 PE=1 SV=1
10	AFDB:Q8UUY8	0.613	0.711	7.180E-23	409	0.283	0.330	Q8UUY8.pdb.gz	ADRB2_ONCMY Beta-2 adrenergic receptor OS=Oncorhynchus mykiss OX=8022 GN=adrb2 PE=2 SV=1
11	AFDB:P41596	0.591	0.552	7.502E-23	511	0.308	0.288	P41596.pdb.gz	DOPR1_DROME Dopamine receptor 1 OS=Drosophila melanogaster OX=7227 GN=Dop1R1 PE=2 SV=2
12	PDB:6iblA	0.531	0.632	4.264E-20	397	0.285	0.343	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
13	PDB:7xt8R	0.526	0.827	1.173E-17	294	0.256	0.415	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
14	PDB:4ldeA	0.506	0.531	4.573E-17	454	0.233	0.244	4ldeA.pdb.gz	Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
15	PDB:7e32R	0.491	0.799	6.788E-17	285	0.231	0.386	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
16	PDB:5d5aA	0.549	0.591	7.092E-17	442	0.254	0.274	5d5aA.pdb.gz	In meso in situ serial X-ray crystallography of soluble and membrane proteins at cryogenic temperatures.
17	PDB:7e2xR	0.504	0.842	1.100E-16	278	0.260	0.446	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
18	PDB:7cmuR	0.512	0.872	2.175E-15	272	0.229	0.401	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
19	PDB:7jvrR	0.495	0.854	2.272E-15	269	0.237	0.420	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:7xtbR	0.490	0.820	2.592E-15	278	0.231	0.396	7xtbR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21918	0.0	986	477	1.000	1.000	DRD5_HUMAN D(1B) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD5 PE=1 SV=2
2	P25115	0.0	775	475	0.824	0.827	DRD5_RAT D(1B) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd5 PE=2 SV=1
3	Q8BLD9	0.0	780	478	0.828	0.826	DRD5_MOUSE D(1B) dopamine receptor OS=Mus musculus OX=10090 GN=Drd5 PE=2 SV=1
4	H0YPZ4	3.91e-170	488	453	0.549	0.578	H0YPZ4_TAEGU Dopamine receptor D1 OS=Taeniopygia guttata OX=59729 GN=DRD1 PE=3 SV=1
5	Q7LZ75	7.21e-168	482	450	0.549	0.582	Q7LZ75_CHICK Dopamine receptor D1A OS=Gallus gallus OX=9031 PE=3 SV=1
6	B8YLW8	4.00e-167	480	451	0.553	0.585	B8YLW8_CHICK Dopamine D1A receptor OS=Gallus gallus OX=9031 GN=D1A PE=2 SV=1
7	G1NR41	2.15e-166	479	451	0.551	0.583	G1NR41_MELGA Dopamine receptor D1 OS=Meleagris gallopavo OX=9103 GN=DRD1 PE=3 SV=1
8	P21728	2.52e-164	473	446	0.541	0.578	DRD1_HUMAN D(1A) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD1 PE=1 SV=1
9	P18901	3.63e-162	468	446	0.551	0.590	DRD1_RAT D(1A) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd1 PE=1 SV=2
10	Q61616	1.31e-161	466	446	0.547	0.585	DRD1_MOUSE D(1A) dopamine receptor OS=Mus musculus OX=10090 GN=Drd1 PE=1 SV=2
11	Q95195	1.80e-96	289	147	0.298	0.966	DRD5_MACMU D(1B) dopamine receptor (Fragment) OS=Macaca mulatta OX=9544 GN=DRD5 PE=2 SV=1
12	P41596	6.85e-72	238	511	0.300	0.280	DOPR1_DROME Dopamine receptor 1 OS=Drosophila melanogaster OX=7227 GN=Dop1R1 PE=2 SV=2
13	P07700	7.58e-70	232	483	0.300	0.296	ADRB1_MELGA Beta-1 adrenergic receptor OS=Meleagris gallopavo OX=9103 GN=ADRB1 PE=1 SV=1
14	B3DHM6	8.59e-69	226	390	0.283	0.346	B3DHM6_DANRE Adrenergic, beta-1-, receptor OS=Danio rerio OX=7955 GN=zgc:194728 PE=2 SV=1
15	G1NEX5	4.98e-68	226	457	0.285	0.298	G1NEX5_MELGA Adrenoceptor beta 1 OS=Meleagris gallopavo OX=9103 GN=ADRB1 PE=3 SV=3
16	I7GPU6	2.13e-65	218	405	0.260	0.306	I7GPU6_DANRE Beta-2 adrenergic receptor OS=Danio rerio OX=7955 GN=adrb2a PE=2 SV=1
17	A0A060YAV5	2.09e-63	212	393	0.264	0.321	A0A060YAV5_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00036180001 PE=3 SV=1
18	P97288	2.38e-63	212	388	0.270	0.332	5HT4R_MOUSE 5-hydroxytryptamine receptor 4 OS=Mus musculus OX=10090 GN=Htr4 PE=1 SV=3
19	P34971	4.56e-63	214	466	0.268	0.275	ADRB1_MOUSE Beta-1 adrenergic receptor OS=Mus musculus OX=10090 GN=Adrb1 PE=1 SV=2
20	P18090	8.84e-63	213	466	0.268	0.275	ADRB1_RAT Beta-1 adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adrb1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	2.6e-65	231.9	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	1.1e-07	43.1	Serpentine type 7TM GPCR chemoreceptor Srsx
3	PF10328 7TM_GPCR_Srx	0.59	21.3	Serpentine type 7TM GPCR chemoreceptor Srx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306129

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360141	0.935	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
2	9606.ENSP00000334051	0.930	Guanine nucleotide-binding protein G(olf) subunit alpha
3	9606.ENSP00000286548	0.862	Guanine nucleotide-binding protein G(q) subunit alpha
4	9606.ENSP00000270349	0.824	Sodium-dependent dopamine transporter
5	9606.ENSP00000377197	0.811	Hydrocephalus-inducing protein homolog
6	9606.ENSP00000261707	0.774	Sodium-dependent serotonin transporter
7	9606.ENSP00000275364	0.773	Guanine nucleotide-binding protein subunit alpha-12
8	9606.ENSP00000373347	0.773	SLIT-ROBO Rho GTPase-activating protein 3
9	9606.ENSP00000474456	0.769	Neuroblastoma breakpoint family member 1
10	9606.ENSP00000320324	0.768	Puromycin-sensitive aminopeptidase
11	9606.ENSP00000320401	0.768	UDP-glucuronosyltransferase 2B17
12	9606.ENSP00000363436	0.768	G protein-regulated inducer of neurite outgrowth 2
13	9606.ENSP00000478609	0.767	Neuroblastoma breakpoint family member 1
14	9606.ENSP00000459615	0.765	SLIT-ROBO Rho GTPase-activating protein 2
15	9606.ENSP00000376776	0.763	Dopamine beta-hydroxylase
16	9606.ENSP00000460070	0.738	General transcription factor II-I
17	9606.ENSP00000372201	0.724	Transmembrane protein 128
18	9606.ENSP00000254976	0.700	Synaptosomal-associated protein 25
19	9606.ENSP00000219833	0.685	Sodium-dependent noradrenaline transporter
20	9606.ENSP00000354511	0.681	Catechol O-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0004952	1.000	dopamine neurotransmitter receptor activity
GO:0005488	0.997	binding
GO:0005515	0.988	protein binding
GO:0097159	0.795	organic cyclic compound binding
GO:0043167	0.746	ion binding
GO:0043169	0.697	cation binding
GO:1901338	0.684	catecholamine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0023052	0.987	signaling
GO:0007154	0.987	cell communication
GO:0051716	0.986	cellular response to stimulus
GO:0007188	0.983	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	0.974	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0042221	0.968	response to chemical
GO:1901698	0.917	response to nitrogen compound
GO:0010033	0.915	response to organic substance
GO:1901700	0.875	response to oxygen-containing compound
GO:0010243	0.860	response to organonitrogen compound
GO:1903350	0.784	response to dopamine
GO:0071868	0.771	cellular response to monoamine stimulus
GO:1903351	0.754	cellular response to dopamine
GO:0032501	0.676	multicellular organismal process
GO:0050790	0.665	regulation of catalytic activity
GO:0007212	0.659	dopamine receptor signaling pathway
GO:0065008	0.425	regulation of biological quality
GO:0044237	0.344	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.980	organelle
GO:0043227	0.967	membrane-bounded organelle
GO:0031090	0.804	organelle membrane
GO:0042995	0.747	cell projection
GO:0005622	0.693	intracellular anatomical structure
GO:0005737	0.644	cytoplasm
GO:0120025	0.631	plasma membrane bounded cell projection
GO:0098590	0.624	plasma membrane region
GO:0043229	0.445	intracellular organelle
GO:0012505	0.395	endomembrane system
GO:0043231	0.382	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]