StarFunc result for job id P21953

User Input

>input (392 residues)
MAVVAAAAGWLLRLRAAGAEGHWRRLPGAGLARGFLHPAATVEDAAQRRQVAHFTFQPDP
EPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVF
NTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSL
TIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEP
KILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCE
VIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRV
CGYDTPFPHIFEPFYIPDKWKCYDALRKMINY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VKB3	0.873	0.873	1.321E-83	392	1.000	1.000	A0A140VKB3.pdb.gz	A0A140VKB3_HUMAN Testis secretory sperm-binding protein Li 240mP OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q93619	0.870	0.931	2.201E-62	366	0.587	0.628	Q93619.pdb.gz	Q93619_CAEEL Transketolase-like pyrimidine-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=bckd-1b PE=1 SV=1
3	AFDB:Q9LDY2	0.830	0.908	3.332E-60	358	0.561	0.615	Q9LDY2.pdb.gz	ODBB2_ARATH 2-oxoisovalerate dehydrogenase subunit beta 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DIN4 PE=1 SV=1
4	AFDB:Q5SLR3	0.811	0.979	1.163E-41	324	0.383	0.463	Q5SLR3.pdb.gz	ODBB_THET8 2-oxoisovalerate dehydrogenase subunit beta OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA0230 PE=1 SV=1
5	PDB:1umbD	0.810	0.981	8.578E-41	323	0.383	0.464	1umbD.pdb.gz	Ligand-induced Conformational Changes and a Reaction Intermediate in Branched-chain 2-Oxo Acid Dehydrogenase (E1) from Thermus thermophilus HB8, as Revealed by X-ray Crystallography
6	AFDB:P21874	0.812	0.977	9.087E-41	325	0.355	0.428	P21874.pdb.gz	ODPB_GEOSE Pyruvate dehydrogenase E1 component subunit beta OS=Geobacillus stearothermophilus OX=1422 GN=pdhB PE=1 SV=2
7	PDB:3dufD	0.809	0.976	1.570E-40	324	0.355	0.429	3dufD.pdb.gz	Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multienzyme complex
8	AFDB:P9WIS1	0.789	0.887	1.152E-39	348	0.327	0.368	P9WIS1.pdb.gz	BKDB_MYCTU 3-methyl-2-oxobutanoate dehydrogenase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=bkdB PE=1 SV=1
9	AFDB:P75391	0.800	0.956	1.369E-37	327	0.314	0.376	P75391.pdb.gz	ODPB_MYCPN Pyruvate dehydrogenase E1 component subunit beta OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=pdhB PE=1 SV=1
10	AFDB:P47515	0.800	0.958	2.221E-37	326	0.314	0.377	P47515.pdb.gz	ODPB_MYCGE Pyruvate dehydrogenase E1 component subunit beta OS=Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37) OX=243273 GN=pdhB PE=3 SV=1
11	AFDB:C8VRK6	0.805	0.840	7.008E-37	375	0.309	0.323	C8VRK6.pdb.gz	C8VRK6_EMENI Pyruvate dehydrogenase E1 component subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09403 PE=4 SV=1
12	AFDB:O64688	0.798	0.771	8.926E-37	406	0.298	0.288	O64688.pdb.gz	ODPB3_ARATH Pyruvate dehydrogenase E1 component subunit beta-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=E1-BETA-2 PE=1 SV=1
13	PDB:6cerD	0.797	0.941	2.207E-35	331	0.288	0.341	6cerD.pdb.gz	Pyruvate dehydrogenase complex deficiency is linked to regulatory loop disorder in the alpha V138M variant of human pyruvate dehydrogenase.
14	PDB:2o1sA	0.661	0.493	2.927E-17	536	0.143	0.104	2o1sA.pdb.gz	Crystal Structure of 1-Deoxy-D-xylulose 5-Phosphate Synthase, a Crucial Enzyme for Isoprenoids Biosynthesis.
15	PDB:6rjbB	0.649	0.423	3.728E-17	622	0.173	0.109	6rjbB.pdb.gz	Low-barrier hydrogen bonds in enzyme cooperativity.
16	PDB:2o1sB	0.671	0.541	7.703E-17	493	0.148	0.118	2o1sB.pdb.gz	Crystal Structure of 1-Deoxy-D-xylulose 5-Phosphate Synthase, a Crucial Enzyme for Isoprenoids Biosynthesis.
17	PDB:7bzy11	0.629	0.433	2.409E-14	584	0.163	0.110	7bzy11.pdb.gz
18	PDB:6u3jA	0.601	0.289	9.637E-13	876	0.171	0.076	6u3jA.pdb.gz	Inhibition and Crystal Structure of the Human DHTKD1-Thiamin Diphosphate Complex.
19	PDB:2jgdA	0.575	0.304	2.115E-12	812	0.148	0.071	2jgdA.pdb.gz	Crystal Structure of the E1 Component of the Escherichia Coli 2-Oxoglutarate Dehydrogenase Multienzyme Complex.
20	PDB:6vefA	0.572	0.292	6.283E-12	844	0.140	0.065	6vefA.pdb.gz	Cryo-EM Structure of Escherichia coli 2-oxoglutarate dehydrogenase E1 component sucA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VKB3	0.0	810	392	1.000	1.000	A0A140VKB3_HUMAN Testis secretory sperm-binding protein Li 240mP OS=Homo sapiens OX=9606 PE=2 SV=1
2	P21953	0.0	810	392	1.000	1.000	ODBB_HUMAN 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHB PE=1 SV=2
3	P35738	0.0	741	390	0.918	0.923	ODBB_RAT 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Bckdhb PE=1 SV=3
4	Q6P3A8	0.0	732	390	0.911	0.915	ODBB_MOUSE 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Bckdhb PE=1 SV=2
5	Q9SAV3	5.23e-165	468	352	0.559	0.622	ODBB1_ARATH 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BCDH BETA1 PE=2 SV=1
6	Q93619	5.88e-164	466	366	0.587	0.628	Q93619_CAEEL Transketolase-like pyrimidine-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=bckd-1b PE=1 SV=1
7	Q9LDY2	2.39e-163	464	358	0.556	0.609	ODBB2_ARATH 2-oxoisovalerate dehydrogenase subunit beta 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DIN4 PE=1 SV=1
8	Q5SLR3	3.54e-100	302	324	0.393	0.475	ODBB_THET8 2-oxoisovalerate dehydrogenase subunit beta OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA0230 PE=1 SV=1
9	P21874	8.10e-88	270	325	0.355	0.428	ODPB_GEOSE Pyruvate dehydrogenase E1 component subunit beta OS=Geobacillus stearothermophilus OX=1422 GN=pdhB PE=1 SV=2
10	P9WIS1	2.28e-75	239	348	0.329	0.371	BKDB_MYCTU 3-methyl-2-oxobutanoate dehydrogenase subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=bkdB PE=1 SV=1
11	P75391	3.40e-69	223	327	0.316	0.379	ODPB_MYCPN Pyruvate dehydrogenase E1 component subunit beta OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=pdhB PE=1 SV=1
12	P47515	5.45e-68	219	326	0.319	0.383	ODPB_MYCGE Pyruvate dehydrogenase E1 component subunit beta OS=Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37) OX=243273 GN=pdhB PE=3 SV=1
13	Q9ZQY2	4.83e-60	200	374	0.304	0.318	Q9ZQY2_MAIZE Pyruvate dehydrogenase E1 component subunit beta OS=Zea mays OX=4577 GN=542483 PE=2 SV=1
14	Q6FMM4	9.99e-60	199	358	0.301	0.330	Q6FMM4_CANGA Pyruvate dehydrogenase E1 component subunit beta OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K06831g PE=4 SV=1
15	P32473	4.34e-59	197	366	0.298	0.320	ODPB_YEAST Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDB1 PE=1 SV=2
16	Q38799	1.15e-58	196	363	0.281	0.303	ODPB1_ARATH Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDH2 PE=1 SV=2
17	O44451	1.48e-56	191	352	0.296	0.330	ODPB_CAEEL Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhb-1 PE=1 SV=2
18	Q9C6Z3	1.93e-56	192	406	0.268	0.259	ODPB2_ARATH Pyruvate dehydrogenase E1 component subunit beta-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PDH-E1 BETA PE=1 SV=1
19	Q7K5K3	3.05e-56	190	365	0.296	0.318	ODPB_DROME Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Pdhb PE=1 SV=1
20	O64688	7.40e-56	190	406	0.268	0.259	ODPB3_ARATH Pyruvate dehydrogenase E1 component subunit beta-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=E1-BETA-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02780 Transketolase_C	2.6e-32	122.7	Transketolase, C-terminal domain
2	PF02779 Transket_pyr	4.9e-40	148.6	Transketolase, pyrimidine binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269980	0.999	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
2	9606.ENSP00000359151	0.997	Dihydrolipoamide branched chain transacylase E2
3	9606.ENSP00000443246	0.997	Uncharacterized protein
4	9606.ENSP00000205402	0.996	Dihydrolipoyl dehydrogenase, mitochondrial
5	9606.ENSP00000477341	0.994	Protein phosphatase 1K, mitochondrial
6	9606.ENSP00000365462	0.988	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
7	9606.ENSP00000419027	0.986	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
8	9606.ENSP00000322991	0.977	Branched-chain-amino-acid aminotransferase, mitochondrial
9	9606.ENSP00000418397	0.977	Isovaleryl-CoA dehydrogenase, mitochondrial
10	9606.ENSP00000378405	0.960	[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial
11	9606.ENSP00000443459	0.960	Branched-chain-amino-acid aminotransferase, cytosolic
12	9606.ENSP00000295266	0.958	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
13	9606.ENSP00000369134	0.958	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
14	9606.ENSP00000377115	0.949	Lipoyltransferase 1, mitochondrial
15	9606.ENSP00000357873	0.944	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
16	9606.ENSP00000335304	0.938	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
17	9606.ENSP00000281182	0.931	Isobutyryl-CoA dehydrogenase, mitochondrial
18	9606.ENSP00000319531	0.926	Glycine cleavage system H protein, mitochondrial
19	9606.ENSP00000257549	0.907	L-serine dehydratase/L-threonine deaminase
20	9606.ENSP00000385790	0.906	Serine dehydratase-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016624	1.000	oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009056	0.996	catabolic process
GO:0006520	0.996	amino acid metabolic process
GO:0009063	0.989	amino acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0031981	0.992	nuclear lumen
GO:0005654	0.982	nucleoplasm
GO:0032991	0.967	protein-containing complex
GO:0005759	0.912	mitochondrial matrix
GO:0043232	0.893	intracellular non-membrane-bounded organelle
GO:1902494	0.857	catalytic complex
GO:0016020	0.833	membrane
GO:0098798	0.683	mitochondrial protein-containing complex
GO:0005730	0.610	nucleolus
GO:1990204	0.608	oxidoreductase complex
GO:0031975	0.438	envelope
GO:0031967	0.336	organelle envelope
GO:0031090	0.322	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.4.-	1.000	With a disulfide as acceptor.

[back to server]