StarFunc result for job id P22003

User Input

>input (454 residues)
MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILG
LPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASP
NGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEF
RFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKA
QALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPF
MVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYV
SFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCA
PTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4ILD5	0.796	0.809	5.113E-68	446	0.751	0.765	A0A0R4ILD5.pdb.gz
2	AFDB:A8K571	0.780	0.820	1.036E-59	431	0.619	0.652	A8K571.pdb.gz	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
3	AFDB:F1NUT2	0.736	0.719	9.993E-59	465	0.617	0.602	F1NUT2.pdb.gz
4	AFDB:F1P4H2	0.747	0.779	1.500E-57	434	0.595	0.622	F1P4H2.pdb.gz
5	AFDB:P22004	0.739	0.657	5.653E-57	513	0.588	0.520	P22004.pdb.gz	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
6	AFDB:Q9PTF9	0.750	0.787	5.666E-54	432	0.535	0.562	Q9PTF9.pdb.gz	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
7	AFDB:D4A7P9	0.355	0.525	1.231E-50	302	0.626	0.940	D4A7P9.pdb.gz	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
8	AFDB:P34820	0.735	0.826	8.524E-50	402	0.456	0.515	P34820.pdb.gz	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
9	AFDB:P34821	0.728	0.824	1.063E-49	399	0.465	0.529	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
10	AFDB:P55105	0.722	0.816	1.190E-46	399	0.441	0.501	P55105.pdb.gz	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
11	PDB:5hlyA	0.252	0.356	1.236E-15	299	0.178	0.271	5hlyA.pdb.gz
12	PDB:5ntuA	0.231	0.327	4.407E-15	308	0.185	0.273	5ntuA.pdb.gz
13	PDB:6umxA	0.256	0.391	5.922E-14	279	0.143	0.233	6umxA.pdb.gz
14	PDB:5nxsA	0.231	0.344	6.614E-14	290	0.181	0.283	5nxsA.pdb.gz
15	PDB:5vqfB	0.223	0.301	4.933E-12	320	0.172	0.244	5vqfB.pdb.gz
16	PDB:3rjrC	0.207	0.265	1.012E-11	343	0.152	0.201	3rjrC.pdb.gz
17	PDB:5ffoG	0.264	0.380	1.287E-10	297	0.156	0.239	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:5nxsB	0.189	0.317	5.126E-10	251	0.150	0.271	5nxsB.pdb.gz
19	PDB:7y1rB	0.237	0.333	1.730E-9	308	0.187	0.276	7y1rB.pdb.gz
20	PDB:6q2sA	0.144	0.534	2.247E-4	98	0.055	0.255	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K571	0.0	580	431	0.623	0.657	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
2	D4A7P9	0.0	894	454	0.936	0.936	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
3	G3V6W8	0.0	586	430	0.632	0.667	G3V6W8_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
4	P18075	0.0	580	431	0.623	0.657	BMP7_HUMAN Bone morphogenetic protein 7 OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
5	P22003	0.0	957	454	1.000	1.000	BMP5_HUMAN Bone morphogenetic protein 5 OS=Homo sapiens OX=9606 GN=BMP5 PE=1 SV=1
6	P23359	0.0	586	430	0.632	0.667	BMP7_MOUSE Bone morphogenetic protein 7 OS=Mus musculus OX=10090 GN=Bmp7 PE=1 SV=2
7	P49003	0.0	882	452	0.927	0.931	BMP5_MOUSE Bone morphogenetic protein 5 OS=Mus musculus OX=10090 GN=Bmp5 PE=1 SV=1
8	Q04906	0.0	519	506	0.599	0.538	BMP6_RAT Bone morphogenetic protein 6 OS=Rattus norvegicus OX=10116 GN=Bmp6 PE=2 SV=2
9	Q7T288	0.0	719	446	0.760	0.774	Q7T288_DANRE Bone morphogenetic protein 5 OS=Danio rerio OX=7955 GN=bmp5l PE=2 SV=1
10	Q9I8T6	0.0	562	398	0.604	0.688	Q9I8T6_CHICK Bone morphogenetic protein 7 (Fragment) OS=Gallus gallus OX=9031 GN=BMP7 PE=2 SV=1
11	P20722	3.29e-179	513	510	0.586	0.522	BMP6_MOUSE Bone morphogenetic protein 6 OS=Mus musculus OX=10090 GN=Bmp6 PE=1 SV=2
12	P22004	8.99e-177	506	513	0.579	0.513	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
13	Q9PTF9	5.74e-168	481	432	0.535	0.562	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
14	Q9R228	1.66e-163	465	306	0.471	0.699	Q9R228_RAT Bone morphogenetic protein 7 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
15	P34821	1.24e-137	402	399	0.449	0.511	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
16	P34820	2.86e-136	399	402	0.449	0.507	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
17	Q7Z5Y6	1.23e-134	395	402	0.443	0.500	BMP8A_HUMAN Bone morphogenetic protein 8A OS=Homo sapiens OX=9606 GN=BMP8A PE=2 SV=2
18	P55105	1.11e-132	390	399	0.443	0.504	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
19	A0A8I6A920	1.05e-120	358	364	0.458	0.571	A0A8I6A920_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
20	P27091	2.77e-83	265	455	0.330	0.330	60A_DROME Protein 60A OS=Drosophila melanogaster OX=7227 GN=gbb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	3.5e-88	306.9	TGF-beta propeptide
2	PF00019 TGF_beta	7.1e-35	131.3	Transforming growth factor beta like domain
3	PF13645 YkuD_2	37	15.2	L,D-transpeptidase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010386249.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351652.1	0.985	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
2	61622.XP_010378782.1	0.982	Bone morphogenetic protein receptor type-1A isoform X1
3	61622.XP_010378952.1	0.975	Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite
4	61622.XP_010383884.1	0.965	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
5	61622.XP_010364462.1	0.953	Dorsalizing factor. Key developmental protein that dorsalizes early vertebrate embryonic tissues by binding to ventralizing TGF-beta family bone morphogenetic proteins (BMPs) and sequestering them in latent complexes
6	61622.XP_010369794.1	0.946	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
7	61622.XP_010353217.1	0.944	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
8	61622.XP_010372220.1	0.877	On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for anti-Muellerian hormone.
9	61622.XP_010385202.1	0.856	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
10	61622.XP_010370358.1	0.847	Bone morphogenetic protein 4
11	61622.XP_010383846.1	0.844	Neuroblastoma suppressor of tumorigenicity 1
12	61622.XP_010386077.1	0.843	Bone morphogenetic protein 2
13	61622.XP_010366895.1	0.818	Gremlin 1, DAN family BMP antagonist
14	61622.XP_010382990.1	0.797	Gremlin 2, DAN family BMP antagonist
15	61622.XP_010355928.1	0.759	Belongs to the protein kinase superfamily.
16	61622.XP_010361528.1	0.759	Belongs to the protein kinase superfamily.
17	61622.XP_010372298.1	0.759	Belongs to the protein kinase superfamily.
18	61622.XP_010355975.1	0.740	Sclerostin domain-containing protein 1
19	61622.XP_010374571.1	0.730	Follistatin isoform X1
20	61622.XP_010372731.1	0.724	Hemochromatosis type 2 (juvenile)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.995	signaling receptor binding
GO:0140677	0.938	molecular function activator activity
GO:0048018	0.910	receptor ligand activity
GO:0042802	0.580	identical protein binding
GO:0046983	0.303	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.991	multicellular organism development
GO:0048522	0.989	positive regulation of cellular process
GO:0009987	0.986	cellular process
GO:0009966	0.983	regulation of signal transduction
GO:0031323	0.977	regulation of cellular metabolic process
GO:0048513	0.960	animal organ development
GO:0009888	0.958	tissue development
GO:0048731	0.938	system development
GO:0060255	0.925	regulation of macromolecule metabolic process
GO:0090092	0.920	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0080090	0.919	regulation of primary metabolic process
GO:0051171	0.919	regulation of nitrogen compound metabolic process
GO:0030154	0.907	cell differentiation
GO:0023056	0.881	positive regulation of signaling
GO:0010647	0.881	positive regulation of cell communication
GO:0050896	0.878	response to stimulus
GO:0060393	0.864	regulation of pathway-restricted SMAD protein phosphorylation
GO:0009893	0.851	positive regulation of metabolic process
GO:0010604	0.829	positive regulation of macromolecule metabolic process
GO:0048519	0.786	negative regulation of biological process
GO:0007154	0.783	cell communication
GO:0051173	0.780	positive regulation of nitrogen compound metabolic process
GO:0031325	0.778	positive regulation of cellular metabolic process
GO:0010468	0.777	regulation of gene expression
GO:0050793	0.768	regulation of developmental process
GO:0051716	0.726	cellular response to stimulus
GO:0007165	0.722	signal transduction
GO:0009889	0.690	regulation of biosynthetic process
GO:0031326	0.639	regulation of cellular biosynthetic process
GO:0019219	0.630	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.599	regulation of RNA metabolic process
GO:0009967	0.592	positive regulation of signal transduction
GO:0051239	0.570	regulation of multicellular organismal process
GO:0048523	0.566	negative regulation of cellular process
GO:1903506	0.565	regulation of nucleic acid-templated transcription
GO:0048468	0.556	cell development
GO:0007166	0.555	cell surface receptor signaling pathway
GO:0006355	0.555	regulation of DNA-templated transcription
GO:0090100	0.541	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0060485	0.519	mesenchyme development
GO:0031328	0.496	positive regulation of cellular biosynthetic process
GO:0009653	0.473	anatomical structure morphogenesis
GO:0045935	0.449	positive regulation of nucleobase-containing compound metabolic process
GO:0071363	0.447	cellular response to growth factor stimulus
GO:0007167	0.431	enzyme-linked receptor protein signaling pathway
GO:0045595	0.427	regulation of cell differentiation
GO:0051094	0.421	positive regulation of developmental process
GO:0010557	0.418	positive regulation of macromolecule biosynthetic process
GO:0001934	0.397	positive regulation of protein phosphorylation
GO:0051240	0.396	positive regulation of multicellular organismal process
GO:0007178	0.357	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0045893	0.350	positive regulation of DNA-templated transcription
GO:0071773	0.330	cellular response to BMP stimulus
GO:0001501	0.329	skeletal system development
GO:2000026	0.325	regulation of multicellular organismal development
GO:0006357	0.320	regulation of transcription by RNA polymerase II
GO:0060429	0.301	epithelium development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0043227	0.996	membrane-bounded organelle
GO:0031982	0.789	vesicle
GO:0005622	0.739	intracellular anatomical structure
GO:0043231	0.525	intracellular membrane-bounded organelle
GO:0005737	0.432	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]