StarFunc result for job id P22004

User Input

>input (513 residues)
MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSP
QSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLP
RGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAH
PLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKF
NLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWA
SEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMV
AFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVS
FQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAP
TKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22004	1.000	1.000	2.345E-96	513	1.000	1.000	P22004.pdb.gz	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
2	AFDB:F1P4H2	0.684	0.804	3.232E-63	434	0.673	0.795	F1P4H2.pdb.gz
3	AFDB:A0A0R4ILD5	0.685	0.784	3.832E-57	446	0.505	0.581	A0A0R4ILD5.pdb.gz
4	AFDB:F1NUT2	0.656	0.722	5.669E-57	465	0.532	0.587	F1NUT2.pdb.gz
5	AFDB:A8K571	0.647	0.765	4.750E-56	431	0.542	0.645	A8K571.pdb.gz	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
6	AFDB:Q9PTF9	0.655	0.774	2.215E-52	432	0.464	0.551	Q9PTF9.pdb.gz	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
7	AFDB:P34821	0.619	0.789	2.603E-45	399	0.421	0.541	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
8	AFDB:P34820	0.608	0.767	1.179E-44	402	0.407	0.520	P34820.pdb.gz	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
9	AFDB:P55105	0.611	0.775	9.789E-43	399	0.388	0.499	P55105.pdb.gz	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
10	AFDB:D4A7P9	0.310	0.512	2.266E-42	302	0.404	0.685	D4A7P9.pdb.gz	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
11	PDB:5hlyA	0.222	0.342	1.091E-16	299	0.164	0.281	5hlyA.pdb.gz
12	PDB:5ntuA	0.229	0.360	1.071E-14	308	0.136	0.227	5ntuA.pdb.gz
13	PDB:5nxsA	0.207	0.342	9.493E-14	290	0.136	0.241	5nxsA.pdb.gz
14	PDB:6umxA	0.222	0.379	3.250E-13	279	0.119	0.219	6umxA.pdb.gz
15	PDB:5vqfB	0.214	0.328	3.437E-13	320	0.140	0.225	5vqfB.pdb.gz
16	PDB:3rjrC	0.216	0.313	3.603E-12	343	0.129	0.192	3rjrC.pdb.gz
17	PDB:7y1rB	0.210	0.332	1.234E-11	308	0.142	0.237	7y1rB.pdb.gz
18	PDB:5ffoG	0.226	0.368	5.908E-11	297	0.138	0.239	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
19	PDB:5nxsB	0.152	0.288	1.516E-9	251	0.127	0.259	5nxsB.pdb.gz
20	PDB:7qe7L	0.170	0.381	4.609E-2	183	0.043	0.120	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K571	0.0	543	431	0.524	0.624	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
2	D4A7P9	0.0	532	454	0.528	0.597	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
3	G3V6W8	0.0	541	430	0.519	0.619	G3V6W8_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
4	P18075	0.0	543	431	0.524	0.624	BMP7_HUMAN Bone morphogenetic protein 7 OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
5	P20722	0.0	824	510	0.897	0.902	BMP6_MOUSE Bone morphogenetic protein 6 OS=Mus musculus OX=10090 GN=Bmp6 PE=1 SV=2
6	P22003	0.0	533	454	0.519	0.586	BMP5_HUMAN Bone morphogenetic protein 5 OS=Homo sapiens OX=9606 GN=BMP5 PE=1 SV=1
7	P22004	0.0	1068	513	1.000	1.000	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
8	P23359	0.0	541	430	0.519	0.619	BMP7_MOUSE Bone morphogenetic protein 7 OS=Mus musculus OX=10090 GN=Bmp7 PE=1 SV=2
9	P49003	0.0	532	452	0.530	0.602	BMP5_MOUSE Bone morphogenetic protein 5 OS=Mus musculus OX=10090 GN=Bmp5 PE=1 SV=1
10	Q04906	0.0	838	506	0.887	0.899	BMP6_RAT Bone morphogenetic protein 6 OS=Rattus norvegicus OX=10116 GN=Bmp6 PE=2 SV=2
11	Q9I8T6	0.0	524	398	0.513	0.661	Q9I8T6_CHICK Bone morphogenetic protein 7 (Fragment) OS=Gallus gallus OX=9031 GN=BMP7 PE=2 SV=1
12	Q7T288	1.02e-178	511	446	0.501	0.576	Q7T288_DANRE Bone morphogenetic protein 5 OS=Danio rerio OX=7955 GN=bmp5l PE=2 SV=1
13	Q9PTF9	1.05e-159	462	432	0.470	0.558	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
14	Q9R228	5.33e-155	445	306	0.398	0.667	Q9R228_RAT Bone morphogenetic protein 7 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
15	Q7Z5Y6	8.34e-124	370	402	0.394	0.502	BMP8A_HUMAN Bone morphogenetic protein 8A OS=Homo sapiens OX=9606 GN=BMP8A PE=2 SV=2
16	P34820	1.04e-123	369	402	0.396	0.505	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
17	P34821	6.00e-119	357	399	0.380	0.489	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
18	P55105	6.60e-117	352	399	0.374	0.481	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
19	A0A8I6A920	5.24e-83	263	364	0.281	0.396	A0A8I6A920_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
20	P27091	1.56e-76	249	455	0.300	0.338	60A_DROME Protein 60A OS=Drosophila melanogaster OX=7227 GN=gbb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00937 CoV_nucleocap	1.6e+02	12.8	Coronavirus nucleocapsid
2	PF00688 TGFb_propeptide	1.3e-91	318.2	TGF-beta propeptide
3	PF00019 TGF_beta	4.6e-36	135.1	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283147

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263640	0.999	Activin receptor type-1
2	9606.ENSP00000361107	0.998	Bone morphogenetic protein receptor type-1A
3	9606.ENSP00000363708	0.993	Bone morphogenetic protein receptor type-2
4	9606.ENSP00000401907	0.992	Bone morphogenetic protein receptor type-1B
5	9606.ENSP00000337014	0.989	Hemojuvelin
6	9606.ENSP00000241416	0.981	Activin receptor type-2A
7	9606.ENSP00000441954	0.978	Mothers against decapentaplegic homolog 5
8	9606.ENSP00000340361	0.965	Activin receptor type-2B
9	9606.ENSP00000426568	0.958	Mothers against decapentaplegic homolog 1
10	9606.ENSP00000364683	0.936	BMP and activin membrane-bound inhibitor homolog
11	9606.ENSP00000393887	0.921	Alpha-2-HS-glycoprotein
12	9606.ENSP00000204604	0.912	Chordin
13	9606.ENSP00000368104	0.897	Bone morphogenetic protein 2
14	9606.ENSP00000420525	0.896	Transferrin receptor protein 2
15	9606.ENSP00000245451	0.895	Bone morphogenetic protein 4
16	9606.ENSP00000328181	0.870	Noggin
17	9606.ENSP00000318650	0.840	Gremlin-2
18	9606.ENSP00000478319	0.813	Gremlin-1
19	9606.ENSP00000471894	0.800	Hepcidin
20	9606.ENSP00000341551	0.774	Mothers against decapentaplegic homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0098772	0.923	molecular function regulator activity
GO:0140677	0.904	molecular function activator activity
GO:0033612	0.890	receptor serine/threonine kinase binding
GO:0042802	0.863	identical protein binding
GO:0046983	0.847	protein dimerization activity
GO:0030545	0.846	signaling receptor regulator activity
GO:0048018	0.843	receptor ligand activity
GO:0070696	0.727	transmembrane receptor protein serine/threonine kinase binding
GO:0046982	0.597	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.990	positive regulation of biological process
GO:0007275	0.985	multicellular organism development
GO:0048522	0.984	positive regulation of cellular process
GO:0009719	0.981	response to endogenous stimulus
GO:0050793	0.980	regulation of developmental process
GO:0051239	0.979	regulation of multicellular organismal process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0007165	0.976	signal transduction
GO:0023051	0.970	regulation of signaling
GO:0010646	0.970	regulation of cell communication
GO:0080090	0.967	regulation of primary metabolic process
GO:0051171	0.967	regulation of nitrogen compound metabolic process
GO:0007166	0.965	cell surface receptor signaling pathway
GO:0048583	0.961	regulation of response to stimulus
GO:0060393	0.959	regulation of pathway-restricted SMAD protein phosphorylation
GO:0051094	0.952	positive regulation of developmental process
GO:0048731	0.949	system development
GO:0007178	0.949	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0045595	0.948	regulation of cell differentiation
GO:0009966	0.947	regulation of signal transduction
GO:0071363	0.945	cellular response to growth factor stimulus
GO:0048523	0.944	negative regulation of cellular process
GO:0071772	0.937	response to BMP
GO:0009893	0.925	positive regulation of metabolic process
GO:0023056	0.923	positive regulation of signaling
GO:0010647	0.923	positive regulation of cell communication
GO:0048513	0.922	animal organ development
GO:2000026	0.918	regulation of multicellular organismal development
GO:0071773	0.915	cellular response to BMP stimulus
GO:0030154	0.903	cell differentiation
GO:0090092	0.903	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0001503	0.896	ossification
GO:0010817	0.894	regulation of hormone levels
GO:0030509	0.888	BMP signaling pathway
GO:0051240	0.879	positive regulation of multicellular organismal process
GO:0045597	0.877	positive regulation of cell differentiation
GO:0001649	0.860	osteoblast differentiation
GO:0001501	0.847	skeletal system development
GO:0090100	0.846	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009888	0.843	tissue development
GO:0045667	0.837	regulation of osteoblast differentiation
GO:0042327	0.826	positive regulation of phosphorylation
GO:0010468	0.824	regulation of gene expression
GO:0001934	0.822	positive regulation of protein phosphorylation
GO:0031328	0.786	positive regulation of cellular biosynthetic process
GO:0035556	0.754	intracellular signal transduction
GO:0010556	0.752	regulation of macromolecule biosynthetic process
GO:0044057	0.745	regulation of system process
GO:0042221	0.731	response to chemical
GO:0009605	0.724	response to external stimulus
GO:0046883	0.722	regulation of hormone secretion
GO:0045669	0.715	positive regulation of osteoblast differentiation
GO:0019219	0.709	regulation of nucleobase-containing compound metabolic process
GO:0044060	0.698	regulation of endocrine process
GO:0046887	0.689	positive regulation of hormone secretion
GO:0042127	0.674	regulation of cell population proliferation
GO:0010033	0.665	response to organic substance
GO:1901700	0.664	response to oxygen-containing compound
GO:0032368	0.662	regulation of lipid transport
GO:0009653	0.659	anatomical structure morphogenesis
GO:0060395	0.658	SMAD protein signal transduction
GO:2000833	0.625	positive regulation of steroid hormone secretion
GO:2001141	0.617	regulation of RNA biosynthetic process
GO:0006355	0.613	regulation of DNA-templated transcription
GO:0060429	0.595	epithelium development
GO:0048468	0.572	cell development
GO:0009887	0.520	animal organ morphogenesis
GO:0010557	0.485	positive regulation of macromolecule biosynthetic process
GO:0045935	0.476	positive regulation of nucleobase-containing compound metabolic process
GO:0008152	0.475	metabolic process
GO:1903508	0.469	positive regulation of nucleic acid-templated transcription
GO:0006357	0.451	regulation of transcription by RNA polymerase II
GO:0045893	0.449	positive regulation of DNA-templated transcription
GO:0009892	0.448	negative regulation of metabolic process
GO:0071704	0.420	organic substance metabolic process
GO:0010605	0.386	negative regulation of macromolecule metabolic process
GO:0008284	0.370	positive regulation of cell population proliferation
GO:0044238	0.365	primary metabolic process
GO:0045944	0.324	positive regulation of transcription by RNA polymerase II
GO:0000003	0.316	reproduction
GO:0007399	0.308	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.919	cell periphery
GO:0043227	0.918	membrane-bounded organelle
GO:0005622	0.829	intracellular anatomical structure
GO:0043231	0.711	intracellular membrane-bounded organelle
GO:0005737	0.692	cytoplasm
GO:0016020	0.408	membrane
GO:0070013	0.406	intracellular organelle lumen
GO:0031982	0.403	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]