StarFunc result for job id P22033

User Input

>input (750 residues)
MLRAKNQLFLLSPHYLRQVKESSGSRLIQQRLLHQQQPLHPEWAALAKKQLKGKNPEDLI
WHTPEGISIKPLYSKRDTMDLPEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESN
KFYKDNIKAGQQGLSVAFDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLE
KMSVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMK
IIADIFEYTAKHMPKFNSISISGYHMQEAGADAILELAYTLADGLEYSRTGLQAGLTIDE
FAPRLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQTSGWSLTE
QDPYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIPK
VADPWGGSYMMECLTNDVYDAALKLINEIEEMGGMAKAVAEGIPKLRIEECAARRQARID
SGSEVIVGVNKYQLEKEDAVEVLAIDNTSVRNRQIEKLKKIKSSRDQALAERCLAALTEC
AASGDGNILALAVDASRARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSA
IKRVHKFMEREGRRPRLLVAKMGQDGHDRGAKVIATGFADLGFDVDIGPLFQTPREVAQQ
AVDADVHAVGISTLAAGHKTLVPELIKELNSLGRPDILVMCGGVIPPQDYEFLFEVGVSN
VFGPGTRIPKAAVQVLDDIEKCLEKKQQSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3bicA	0.935	0.981	0.000	715	0.949	0.996	3bicA.pdb.gz
2	AFDB:P22033	1.000	1.000	0.000	750	1.000	1.000	P22033.pdb.gz	MUTA_HUMAN Methylmalonyl-CoA mutase, mitochondrial OS=Homo sapiens OX=9606 GN=MMUT PE=1 SV=4
3	AFDB:Q23381	0.953	0.961	5.827E-100	744	0.685	0.691	Q23381.pdb.gz	MUTA_CAEEL Probable methylmalonyl-CoA mutase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mmcm-1 PE=3 SV=2
4	AFDB:A0A0E8UW09	0.926	0.926	3.545E-90	750	0.592	0.592	A0A0E8UW09.pdb.gz	A0A0E8UW09_MYCTX Methylmalonyl-CoA mutase OS=Mycobacterium tuberculosis OX=1773 GN=mutB PE=1 SV=1
5	AFDB:P27253	0.927	0.973	1.349E-87	714	0.557	0.585	P27253.pdb.gz	SCPA_ECOLI Methylmalonyl-CoA mutase OS=Escherichia coli (strain K12) OX=83333 GN=scpA PE=1 SV=2
6	AFDB:P11653	0.923	0.950	2.336E-86	728	0.569	0.587	P11653.pdb.gz	MUTB_PROFR Methylmalonyl-CoA mutase large subunit OS=Propionibacterium freudenreichii subsp. shermanii OX=1752 GN=mutB PE=1 SV=3
7	PDB:6oxdA	0.926	0.943	1.785E-85	736	0.585	0.596	6oxdA.pdb.gz	Itaconyl-CoA forms a stable biradical in methylmalonyl-CoA mutase and derails its activity and repair.
8	PDB:1e1cA	0.921	0.950	1.047E-80	727	0.565	0.583	1e1cA.pdb.gz	Protection of Radical Intermediates at the Active Site of Adenosylcobalamin-Dependent Methylmalonyl-Coa Mutase
9	AFDB:A7IQE5	0.683	0.911	4.961E-43	559	0.233	0.313	A7IQE5.pdb.gz	PCMA_XANP2 Pivalyl-CoA mutase large subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) OX=78245 GN=Xaut_5043 PE=1 SV=1
10	AFDB:Q5Z110	0.626	0.442	5.689E-36	1071	0.253	0.177	Q5Z110.pdb.gz	ICMF_NOCFA Fused isobutyryl-CoA mutase OS=Nocardia farcinica (strain IFM 10152) OX=247156 GN=icmF PE=1 SV=1
11	AFDB:Q146L7	0.620	0.369	1.958E-35	1272	0.259	0.153	Q146L7.pdb.gz	ICMF_PARXL Fused isobutyryl-CoA mutase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=icmF PE=1 SV=1
12	PDB:4xc6A	0.619	0.440	3.771E-35	1067	0.259	0.182	4xc6A.pdb.gz	Visualization of a radical B12 enzyme with its G-protein chaperone.
13	AFDB:Q1LRY0	0.626	0.434	8.147E-35	1093	0.259	0.177	Q1LRY0.pdb.gz	ICMF_CUPMC Fused isobutyryl-CoA mutase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=icmF PE=1 SV=1
14	AFDB:Q5KUG0	0.629	0.438	1.374E-34	1086	0.247	0.170	Q5KUG0.pdb.gz	ICMF_GEOKA Fused isobutyryl-CoA mutase OS=Geobacillus kaustophilus (strain HTA426) OX=235909 GN=icmF PE=1 SV=1
15	PDB:6oxcB	0.519	0.649	9.857E-31	591	0.209	0.266	6oxcB.pdb.gz	Itaconyl-CoA forms a stable biradical in methylmalonyl-CoA mutase and derails its activity and repair.
16	PDB:7reqB	0.558	0.666	1.284E-29	623	0.216	0.260	7reqB.pdb.gz	Crystal structure of substrate complexes of methylmalonyl-CoA mutase.
17	PDB:1cb7B	0.365	0.541	3.610E-6	483	0.072	0.112	1cb7B.pdb.gz	Glutamate mutase from Clostridium cochlearium: the structure of a coenzyme B12-dependent enzyme provides new mechanistic insights.
18	PDB:3t0cA	0.231	0.234	1.403E-4	737	0.105	0.107	3t0cA.pdb.gz	Crystal Structures of Cobalamin-Independent Methionine Synthase (MetE) from Streptococcus mutans: A Dynamic Zinc-Inversion Model
19	PDB:4s2aA	0.253	0.309	7.763E-4	594	0.067	0.084	4s2aA.pdb.gz	Non-canonical active site architecture of the radical SAM thiamin pyrimidine synthase.
20	PDB:1cb7A	0.161	0.820	1.309E-3	137	0.040	0.219	1cb7A.pdb.gz	Glutamate mutase from Clostridium cochlearium: the structure of a coenzyme B12-dependent enzyme provides new mechanistic insights.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0E8UW09	0.0	904	750	0.588	0.588	A0A0E8UW09_MYCTX Methylmalonyl-CoA mutase OS=Mycobacterium tuberculosis OX=1773 GN=mutB PE=1 SV=1
2	P11653	0.0	871	728	0.568	0.585	MUTB_PROFR Methylmalonyl-CoA mutase large subunit OS=Propionibacterium freudenreichii subsp. shermanii OX=1752 GN=mutB PE=1 SV=3
3	P16332	0.0	1483	748	0.948	0.951	MUTA_MOUSE Methylmalonyl-CoA mutase, mitochondrial OS=Mus musculus OX=10090 GN=Mmut PE=1 SV=2
4	P22033	0.0	1558	750	1.000	1.000	MUTA_HUMAN Methylmalonyl-CoA mutase, mitochondrial OS=Homo sapiens OX=9606 GN=MMUT PE=1 SV=4
5	P27253	0.0	847	714	0.560	0.588	SCPA_ECOLI Methylmalonyl-CoA mutase OS=Escherichia coli (strain K12) OX=83333 GN=scpA PE=1 SV=2
6	P9WJK5	0.0	904	750	0.588	0.588	MUTB_MYCTU Probable methylmalonyl-CoA mutase large subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mutB PE=1 SV=1
7	Q23381	0.0	1080	744	0.689	0.695	MUTA_CAEEL Probable methylmalonyl-CoA mutase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mmcm-1 PE=3 SV=2
8	A7IQE5	3.14e-84	280	559	0.240	0.322	PCMA_XANP2 Pivalyl-CoA mutase large subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) OX=78245 GN=Xaut_5043 PE=1 SV=1
9	Q1LRY0	3.23e-78	274	1093	0.253	0.174	ICMF_CUPMC Fused isobutyryl-CoA mutase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=icmF PE=1 SV=1
10	Q146L7	7.11e-77	272	1272	0.259	0.153	ICMF_PARXL Fused isobutyryl-CoA mutase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=icmF PE=1 SV=1
11	Q5Z110	9.04e-74	261	1071	0.243	0.170	ICMF_NOCFA Fused isobutyryl-CoA mutase OS=Nocardia farcinica (strain IFM 10152) OX=247156 GN=icmF PE=1 SV=1
12	Q5KUG0	1.75e-71	255	1086	0.243	0.168	ICMF_GEOKA Fused isobutyryl-CoA mutase OS=Geobacillus kaustophilus (strain HTA426) OX=235909 GN=icmF PE=1 SV=1
13	U2WQ53	1.77e-71	255	1086	0.243	0.168	U2WQ53_GEOKU Fused isobutyryl-CoA mutase OS=Geobacillus kaustophilus GBlys OX=1337888 GN=icmF PE=3 SV=1
14	P11652	4.03e-42	165	638	0.188	0.221	MUTA_PROFR Methylmalonyl-CoA mutase small subunit OS=Propionibacterium freudenreichii subsp. shermanii OX=1752 GN=mutA PE=1 SV=3
15	A0A045IZR3	4.12e-28	122	615	0.183	0.223	A0A045IZR3_MYCTX methylmalonyl-CoA mutase OS=Mycobacterium tuberculosis OX=1773 GN=mutA PE=1 SV=1
16	P9WJK7	4.12e-28	122	615	0.183	0.223	MUTA_MYCTU Probable methylmalonyl-CoA mutase small subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mutA PE=1 SV=1
17	A7IQE6	6.97e-15	74.7	148	0.065	0.331	PCMB_XANP2 Pivalyl-CoA mutase small subunit OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) OX=78245 GN=Xaut_5044 PE=1 SV=1
18	Q59268	4.00e-09	62.4	614	0.064	0.078	MGM_EUBBA 2-methyleneglutarate mutase OS=Eubacterium barkeri OX=1528 GN=mgm PE=1 SV=1
19	P80078	0.055	37.4	137	0.047	0.255	GMSS_CLOCO Glutamate mutase sigma subunit OS=Clostridium cochlearium OX=1494 GN=glmS PE=1 SV=2
20	Q6P179	0.85	35.4	960	0.039	0.030	ERAP2_HUMAN Endoplasmic reticulum aminopeptidase 2 OS=Homo sapiens OX=9606 GN=ERAP2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02310 B12-binding	6.1e-12	57.0	B12 binding domain
2	PF01642 MM_CoA_mutase	1.2e-228	771.5	Methylmalonyl-CoA mutase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281317	0.998	Methylmalonic aciduria type A protein, mitochondrial
2	9606.ENSP00000244217	0.991	Methylmalonyl-CoA epimerase, mitochondrial
3	9606.ENSP00000445920	0.960	Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
4	9606.ENSP00000419325	0.953	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
5	9606.ENSP00000377446	0.952	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
6	9606.ENSP00000367923	0.948	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
7	9606.ENSP00000419027	0.940	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
8	9606.ENSP00000365462	0.930	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
9	9606.ENSP00000479130	0.922	Acyl-CoA synthetase family member 3, mitochondrial
10	9606.ENSP00000389060	0.919	Methylmalonic aciduria and homocystinuria type D protein, mitochondrial
11	9606.ENSP00000377532	0.887	Pyruvate carboxylase, mitochondrial
12	9606.ENSP00000342056	0.879	Citrate synthase, mitochondrial
13	9606.ENSP00000253792	0.868	ATP-citrate synthase
14	9606.ENSP00000383840	0.861	Methylmalonic aciduria and homocystinuria type C protein
15	9606.ENSP00000327070	0.852	Malate dehydrogenase, mitochondrial
16	9606.ENSP00000355536	0.846	Methionine synthase
17	9606.ENSP00000220592	0.845	Protein argonaute-2
18	9606.ENSP00000356953	0.841	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
19	9606.ENSP00000359609	0.833	Probable lysosomal cobalamin transporter
20	9606.ENSP00000438144	0.831	Malate dehydrogenase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016866	0.999	intramolecular transferase activity
GO:0005515	0.997	protein binding
GO:1901363	0.956	heterocyclic compound binding
GO:0097159	0.956	organic cyclic compound binding
GO:0004494	0.934	methylmalonyl-CoA mutase activity
GO:0036094	0.896	small molecule binding
GO:0046906	0.870	tetrapyrrole binding
GO:0019842	0.864	vitamin binding
GO:0031419	0.833	cobalamin binding
GO:0042802	0.814	identical protein binding
GO:0016787	0.677	hydrolase activity
GO:0003924	0.444	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.998	metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:1901564	0.956	organonitrogen compound metabolic process
GO:0044281	0.903	small molecule metabolic process
GO:0006790	0.901	sulfur compound metabolic process
GO:0065007	0.579	biological regulation
GO:0019752	0.379	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.958	intracellular organelle lumen
GO:0005829	0.524	cytosol
GO:0005759	0.514	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.4.-.-	0.999	Intramolecular transferases.
RHEA:22888	0.934	(R)-methylmalonyl-CoA = succinyl-CoA
EC:5.4.99.2	0.934	methylmalonyl-CoA mutase.
EC:3.-.-.-	0.677	Hydrolases.
RHEA:19669	0.444	GTP + H2O = GDP + H(+) + phosphate

[back to server]