StarFunc result for job id P22059

User Input

>input (807 residues)
MAATELRGVVGPGPAAIAALGGGGAGPPVVGGGGGRGDAGPGSGAASGTVVAAAAGGPGP
GAGGVAAAGPAPAPPTGGSGGSGAGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSYY
RSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAK
AKAVKMLAESDESGDEESVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQRSLS
ELESLKLPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQ
RIRLEETLEQLAKQHNHLERAFRGATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFF
DAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLW
SIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFT
VSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLR
QEIKITSKFRGKYLSIMPLGTIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDI
VNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMECFKVQPVIG
ENGGDARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWESGTAPTDSRLRPD
QRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTPYDPYKALWFERKKDPVT
KELTHIYRGEYWECKEKQDWSSCPDIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16258	0.509	0.508	0.000	809	0.979	0.977	P16258.pdb.gz	OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus OX=9986 GN=OSBP PE=1 SV=1
2	AFDB:Q5QNQ6	0.480	0.428	2.004E-86	908	0.587	0.522	Q5QNQ6.pdb.gz	OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus OX=10090 GN=Osbp2 PE=1 SV=1
3	AFDB:O18397	0.487	0.501	6.518E-76	784	0.466	0.480	O18397.pdb.gz	O18397_DROME Oxysterol-binding protein OS=Drosophila melanogaster OX=7227 GN=Osbp PE=2 SV=2
4	AFDB:O13944	0.442	0.380	2.899E-42	945	0.242	0.206	O13944.pdb.gz	OSH3_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=osh3 PE=1 SV=2
5	AFDB:Q9H1P3	0.458	0.760	1.453E-38	480	0.219	0.369	Q9H1P3.pdb.gz	OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens OX=9606 GN=OSBPL2 PE=1 SV=1
6	AFDB:P38713	0.456	0.374	2.529E-37	996	0.235	0.191	P38713.pdb.gz	OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH3 PE=1 SV=1
7	PDB:5zm8B	0.431	0.827	2.361E-36	413	0.203	0.397	5zm8B.pdb.gz	ORP2 Delivers Cholesterol to the Plasma Membrane in Exchange for Phosphatidylinositol 4, 5-Bisphosphate (PI(4,5)P2).
8	PDB:5zm8A	0.407	0.841	3.041E-35	386	0.202	0.422	5zm8A.pdb.gz	ORP2 Delivers Cholesterol to the Plasma Membrane in Exchange for Phosphatidylinositol 4, 5-Bisphosphate (PI(4,5)P2).
9	AFDB:Q9BXB5	0.357	0.377	3.107E-35	764	0.183	0.194	Q9BXB5.pdb.gz	OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens OX=9606 GN=OSBPL10 PE=1 SV=2
10	AFDB:A0A140VJQ6	0.351	0.378	2.325E-31	747	0.190	0.205	A0A140VJQ6.pdb.gz	A0A140VJQ6_HUMAN Oxysterol-binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
11	AFDB:Q54QP6	0.417	0.821	1.343E-30	402	0.170	0.341	Q54QP6.pdb.gz	OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum OX=44689 GN=osbH PE=1 SV=1
12	AFDB:Q93Y40	0.405	0.701	1.288E-27	457	0.152	0.269	Q93Y40.pdb.gz	ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana OX=3702 GN=ORP3C PE=2 SV=1
13	PDB:4ph7D	0.357	0.674	1.003E-19	407	0.102	0.201	4ph7D.pdb.gz	INTRACELLULAR TRANSPORT. Phosphatidylserine transport by ORP/Osh proteins is driven by phosphatidylinositol 4-phosphate.
14	PDB:4jchA	0.345	0.604	2.634E-14	436	0.099	0.183	4jchA.pdb.gz	Structure of OSH4 bound to an electrophilic oxysterol
15	PDB:3spwA	0.339	0.655	1.185E-13	398	0.100	0.204	3spwA.pdb.gz	Osh4p exchanges sterols for phosphatidylinositol 4-phosphate between lipid bilayers.
16	PDB:4iapA	0.091	0.280	4.238E-5	256	0.031	0.098	4iapA.pdb.gz
17	PDB:6u3eA	0.110	0.215	7.354E-5	397	0.042	0.086	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:4mk0A	0.112	0.141	1.483E-4	631	0.022	0.029	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:6bbpA	0.101	0.154	3.146E-4	520	0.038	0.060	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:7c3mA	0.105	0.144	9.474E-4	577	0.041	0.057	7c3mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A9D8	0.0	1634	805	0.971	0.974	D4A9D8_RAT Oxysterol-binding protein OS=Rattus norvegicus OX=10116 GN=Osbp PE=1 SV=3
2	O18397	0.0	575	784	0.440	0.453	O18397_DROME Oxysterol-binding protein OS=Drosophila melanogaster OX=7227 GN=Osbp PE=2 SV=2
3	P16258	0.0	1644	809	0.980	0.978	OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus OX=9986 GN=OSBP PE=1 SV=1
4	P22059	0.0	1684	807	1.000	1.000	OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1
5	Q3B7Z2	0.0	1446	805	0.865	0.867	OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus OX=10090 GN=Osbp PE=1 SV=3
6	Q5QNQ6	0.0	918	908	0.574	0.510	OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus OX=10090 GN=Osbp2 PE=1 SV=1
7	Q969R2	0.0	946	916	0.582	0.513	OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens OX=9606 GN=OSBP2 PE=1 SV=2
8	Q9VC05	0.0	579	784	0.441	0.454	Q9VC05_DROME Oxysterol-binding protein OS=Drosophila melanogaster OX=7227 GN=Osbp PE=1 SV=1
9	Q91XL9	6.18e-94	317	950	0.323	0.275	OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus OX=10090 GN=Osbpl1a PE=1 SV=2
10	Q9BXW6	4.16e-93	314	950	0.318	0.271	OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens OX=9606 GN=OSBPL1A PE=1 SV=2
11	Q8K4M9	4.16e-92	311	950	0.323	0.275	OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus OX=10116 GN=Osbpl1a PE=1 SV=1
12	Q9H4L5	2.89e-87	297	887	0.214	0.195	OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3 PE=1 SV=1
13	Q9H1P3	1.03e-80	269	480	0.212	0.356	OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens OX=9606 GN=OSBPL2 PE=1 SV=1
14	P35845	1.53e-80	283	1188	0.204	0.139	OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWH1 PE=1 SV=4
15	Q12451	1.45e-79	281	1283	0.206	0.129	OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OSH2 PE=1 SV=1
16	Q9BZF3	1.15e-77	272	934	0.253	0.218	OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens OX=9606 GN=OSBPL6 PE=1 SV=1
17	O14340	1.18e-76	273	1310	0.202	0.124	YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2F12.05c PE=1 SV=2
18	Q9BZF2	1.25e-72	256	842	0.186	0.178	OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens OX=9606 GN=OSBPL7 PE=1 SV=1
19	Q54QP6	3.12e-60	211	402	0.162	0.326	OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum OX=44689 GN=osbH PE=1 SV=1
20	Q93Y40	1.98e-50	186	457	0.143	0.252	ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana OX=3702 GN=ORP3C PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16576 HlyD_D23	3.3e+02	11.9	Barrel-sandwich domain of CusB or HlyD membrane-fusion
2	PF01237 Oxysterol_BP	2.5e-137	469.3	Oxysterol-binding protein
3	PF00169 PH	2.4e-12	58.6	PH domain
4	PF15413 PH_11	0.1	24.5	Pleckstrin homology domain
5	PF20399 PH_20	1e+02	14.4	PH domain
6	PF15406 PH_6	0.046	25.4	Pleckstrin homology domain
7	PF15409 PH_8	3e-08	45.2	Pleckstrin homology domain
8	PF01329 Pterin_4a	3.6e+02	12.7	Pterin 4 alpha carbinolamine dehydratase
9	PF09177 Syntaxin-6_N	73	15.2	Syntaxin 6, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263847

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345656	0.999	Vesicle-associated membrane protein-associated protein A
2	9606.ENSP00000417175	0.989	Vesicle-associated membrane protein-associated protein B/C
3	9606.ENSP00000369862	0.942	Collagen type IV alpha-3-binding protein
4	9606.ENSP00000450838	0.930	Kallistatin
5	9606.ENSP00000377036	0.928	Serine/threonine-protein phosphatase 2A activator
6	9606.ENSP00000440005	0.906	ADP-ribosylation factor 1
7	9606.ENSP00000417659	0.902	Protein phosphatase 1L
8	9606.ENSP00000265062	0.884	Ras-related protein Rab-7a
9	9606.ENSP00000373713	0.871	Phosphatidylinositide phosphatase SAC1
10	9606.ENSP00000357869	0.859	Phosphatidylinositol 4-kinase beta
11	9606.ENSP00000369860	0.800	Motile sperm domain-containing protein 2
12	9606.ENSP00000348772	0.796	Membrane-associated phosphatidylinositol transfer protein 1
13	9606.ENSP00000255882	0.778	Phosphatidylinositol 4-kinase alpha
14	9606.ENSP00000234313	0.749	Pleckstrin
15	9606.ENSP00000314499	0.724	Cyclin-G-associated kinase
16	9606.ENSP00000355777	0.712	Golgi resident protein GCP60
17	9606.ENSP00000252037	0.683	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
18	9606.ENSP00000319799	0.682	Histone H1oo
19	9606.ENSP00000359000	0.679	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
20	9606.ENSP00000260385	0.677	Regulator of microtubule dynamics protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0015485	0.998	cholesterol binding
GO:0005319	0.995	lipid transporter activity
GO:0015248	0.958	sterol transporter activity
GO:0120013	0.891	lipid transfer activity
GO:0005543	0.869	phospholipid binding
GO:0120015	0.826	sterol transfer activity
GO:0035091	0.637	phosphatidylinositol binding
GO:1901981	0.612	phosphatidylinositol phosphate binding
GO:0070273	0.333	phosphatidylinositol-4-phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0006810	0.979	transport
GO:0033036	0.975	macromolecule localization
GO:0050789	0.963	regulation of biological process
GO:0071702	0.951	organic substance transport
GO:0046907	0.945	intracellular transport
GO:0050794	0.937	regulation of cellular process
GO:0071704	0.898	organic substance metabolic process
GO:0044238	0.888	primary metabolic process
GO:0044237	0.880	cellular metabolic process
GO:0006807	0.848	nitrogen compound metabolic process
GO:0048518	0.847	positive regulation of biological process
GO:0006869	0.847	lipid transport
GO:0006643	0.842	membrane lipid metabolic process
GO:0019222	0.822	regulation of metabolic process
GO:0008610	0.809	lipid biosynthetic process
GO:0032879	0.808	regulation of localization
GO:0008202	0.760	steroid metabolic process
GO:0031323	0.759	regulation of cellular metabolic process
GO:0048522	0.758	positive regulation of cellular process
GO:0032365	0.756	intracellular lipid transport
GO:1901564	0.748	organonitrogen compound metabolic process
GO:0051049	0.722	regulation of transport
GO:0015748	0.717	organophosphate ester transport
GO:0015850	0.705	organic hydroxy compound transport
GO:0015918	0.675	sterol transport
GO:0044249	0.620	cellular biosynthetic process
GO:0051174	0.619	regulation of phosphorus metabolic process
GO:1901615	0.614	organic hydroxy compound metabolic process
GO:0071705	0.610	nitrogen compound transport
GO:0006665	0.599	sphingolipid metabolic process
GO:0006694	0.581	steroid biosynthetic process
GO:0006793	0.567	phosphorus metabolic process
GO:0008206	0.566	bile acid metabolic process
GO:0072330	0.500	monocarboxylic acid biosynthetic process
GO:0060341	0.487	regulation of cellular localization
GO:0050708	0.483	regulation of protein secretion
GO:1903532	0.481	positive regulation of secretion by cell
GO:0019637	0.473	organophosphate metabolic process
GO:0050796	0.466	regulation of insulin secretion
GO:0071840	0.427	cellular component organization or biogenesis
GO:0080090	0.407	regulation of primary metabolic process
GO:0016043	0.386	cellular component organization
GO:0043603	0.379	amide metabolic process
GO:0042886	0.353	amide transport
GO:0030301	0.323	cholesterol transport
GO:0015914	0.307	phospholipid transport
GO:0046887	0.306	positive regulation of hormone secretion
GO:0050896	0.301	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0012505	0.991	endomembrane system
GO:0016020	0.986	membrane
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0070013	0.947	intracellular organelle lumen
GO:0031090	0.890	organelle membrane
GO:0005634	0.847	nucleus
GO:0031984	0.846	organelle subcompartment
GO:0005794	0.818	Golgi apparatus
GO:0005783	0.732	endoplasmic reticulum
GO:0031981	0.731	nuclear lumen
GO:0005654	0.720	nucleoplasm
GO:0098588	0.700	bounding membrane of organelle
GO:0098827	0.559	endoplasmic reticulum subcompartment
GO:0042175	0.509	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.504	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.958	cholesterol(in) = cholesterol(out)

[back to server]