StarFunc result for job id P22083

User Input

>input (530 residues)
MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALA
ARPARHLGGAGQGPRPLHSGTAPFHSRASGERQRRLEPQLQHESRCRSSTPADAWRAEAA
LPVRAMGAPWGSPTAAAGGRRGWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPW
ASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHR
DLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESP
SHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWV
VSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLD
YITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPA
VYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22083	1.000	1.000	0.000	530	1.000	1.000	P22083.pdb.gz	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
2	AFDB:Q62994	0.654	0.792	3.767E-72	433	0.628	0.769	Q62994.pdb.gz	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
3	AFDB:Q11127	0.646	0.785	1.322E-70	433	0.600	0.734	Q11127.pdb.gz	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
4	AFDB:Q11131	0.530	0.713	6.797E-42	389	0.323	0.440	Q11131.pdb.gz	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
5	AFDB:O88819	0.531	0.775	1.448E-40	359	0.279	0.412	O88819.pdb.gz	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
6	AFDB:P51993	0.534	0.778	2.106E-40	359	0.300	0.443	P51993.pdb.gz	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
7	AFDB:G3MZR2	0.529	0.806	4.742E-40	342	0.313	0.485	G3MZR2.pdb.gz	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
8	AFDB:Q11130	0.533	0.810	5.718E-40	342	0.294	0.456	Q11130.pdb.gz	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
9	AFDB:Q11128	0.530	0.742	8.916E-39	374	0.294	0.417	Q11128.pdb.gz	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
10	PDB:7sckB	0.271	0.247	1.597E-4	598	0.106	0.094	7sckB.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
11	PDB:7au2A	0.264	0.217	2.472E-4	686	0.111	0.086	7au2A.pdb.gz
12	PDB:5l0tA	0.206	0.289	4.912E-4	356	0.055	0.081	5l0tA.pdb.gz	Structural basis of Notch O-glucosylation and O-xylosylation by mammalian protein-O-glucosyltransferase 1 (POGLUT1).
13	PDB:5f84A	0.227	0.315	1.712E-3	365	0.051	0.074	5f84A.pdb.gz	Structural analysis of Notch-regulating Rumi reveals basis for pathogenic mutations.
14	PDB:7scjA	0.221	0.211	3.621E-3	563	0.074	0.069	7scjA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
15	PDB:1ixyA	0.304	0.423	6.351E-3	351	0.074	0.111	1ixyA.pdb.gz	A Base-flipping Mechanism for the T4 Phage beta-Glucosyltransferase and Identification of a Transition-state Analog
16	PDB:1ya6A	0.267	0.351	8.153E-3	380	0.074	0.103	1ya6A.pdb.gz	Structural evidence of a passive base-flipping mechanism for AGT, an unusual GT-B glycosyltransferase.
17	PDB:1bgtA	0.187	0.289	8.678E-3	329	0.038	0.061	1bgtA.pdb.gz
18	PDB:1f0kA	0.184	0.254	1.724E-2	351	0.062	0.094	1f0kA.pdb.gz
19	PDB:7jlxA	0.127	0.316	1.835E-2	166	0.042	0.133	7jlxA.pdb.gz
20	AFDB:A9UL56	0.127	0.103	5.540E-1	710	0.128	0.096	A9UL56.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22083	0.0	1059	530	1.000	1.000	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
2	Q11127	0.0	640	433	0.608	0.744	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
3	Q62994	0.0	648	433	0.632	0.774	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
4	G3MZR2	2.50e-81	259	342	0.315	0.488	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
5	O88819	7.32e-81	258	359	0.262	0.387	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
6	Q99JB3	1.86e-80	257	359	0.262	0.387	FUT9_RAT 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
7	Q9Y231	2.20e-80	257	359	0.260	0.384	FUT9_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Homo sapiens OX=9606 GN=FUT9 PE=1 SV=2
8	Q11131	7.59e-79	254	389	0.296	0.404	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
9	Q712G6	1.56e-78	253	370	0.298	0.427	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
10	Q11130	1.86e-78	251	342	0.287	0.444	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
11	Q9P1W6	2.09e-77	249	361	0.287	0.421	Q9P1W6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT3 PE=2 SV=1
12	P21217	2.25e-77	249	361	0.287	0.421	FUT3_HUMAN 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Homo sapiens OX=9606 GN=FUT3 PE=1 SV=1
13	Q11128	1.14e-76	248	374	0.287	0.406	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
14	P51993	1.91e-75	244	359	0.285	0.421	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
15	Q6P7E6	1.05e-73	239	359	0.281	0.415	Q6P7E6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
16	Q9VUL9	1.80e-33	135	503	0.157	0.165	FUCTA_DROME Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=1 SV=2
17	G5EDR5	3.45e-29	122	433	0.164	0.201	FUTA_CAEEL Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabditis elegans OX=6239 GN=fut-1 PE=1 SV=1
18	G5EEE1	2.43e-25	110	392	0.158	0.214	FUTE_CAEEL Alpha-(1,3)-fucosyltransferase fut-6 OS=Caenorhabditis elegans OX=6239 GN=fut-6 PE=1 SV=1
19	G5EE06	4.59e-25	108	378	0.166	0.233	FUTD_CAEEL Alpha-(1,3)-fucosyltransferase fut-5 OS=Caenorhabditis elegans OX=6239 GN=fut-5 PE=1 SV=1
20	G5EFP5	1.69e-21	99.0	400	0.162	0.215	FUTC_CAEEL Alpha-(1,3)-fucosyltransferase fut-3 OS=Caenorhabditis elegans OX=6239 GN=fut-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00852 Glyco_transf_10	4.1e-61	217.3	Glycosyltransferase family 10 (fucosyltransferase) C-term
2	PF17039 Glyco_tran_10_N	2.6e-34	129.4	Fucosyltransferase, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351602

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263686	0.981	P-selectin
2	9606.ENSP00000387498	0.978	Galactoside 2-alpha-L-fucosyltransferase 2
3	9606.ENSP00000312021	0.977	Galactoside 2-alpha-L-fucosyltransferase 1
4	9606.ENSP00000480884	0.944	Type 2 lactosamine alpha-2,3-sialyltransferase
5	9606.ENSP00000321874	0.941	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
6	9606.ENSP00000315477	0.939	CD209 antigen
7	9606.ENSP00000368917	0.923	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
8	9606.ENSP00000305595	0.922	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
9	9606.ENSP00000369055	0.922	Beta-1,4-galactosyltransferase 1
10	9606.ENSP00000420161	0.916	Beta-1,4-galactosyltransferase 4
11	9606.ENSP00000310696	0.915	Beta-1,4-galactosyltransferase 2
12	9606.ENSP00000302599	0.910	Alpha-(1,3)-fucosyltransferase 9
13	9606.ENSP00000305603	0.910	Galactoside 3(4)-L-fucosyltransferase
14	9606.ENSP00000466880	0.910	Alpha-(1,3)-fucosyltransferase 5
15	9606.ENSP00000313398	0.909	Alpha-(1,3)-fucosyltransferase 6
16	9606.ENSP00000319636	0.909	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
17	9606.ENSP00000480428	0.905	Beta-1,4-galactosyltransferase 3
18	9606.ENSP00000379353	0.901	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
19	9606.ENSP00000483018	0.901	Histo-blood group ABO system transferase
20	9606.ENSP00000331736	0.900	E-selectin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046920	1.000	alpha-(1->3)-fucosyltransferase activity
GO:0017083	0.865	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity
GO:0005488	0.508	binding
GO:0005515	0.443	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0070085	0.977	glycosylation
GO:0044238	0.976	primary metabolic process
GO:0009101	0.966	glycoprotein biosynthetic process
GO:0006486	0.931	protein glycosylation
GO:0006643	0.926	membrane lipid metabolic process
GO:0030155	0.918	regulation of cell adhesion
GO:0022407	0.906	regulation of cell-cell adhesion
GO:0005975	0.884	carbohydrate metabolic process
GO:1903037	0.860	regulation of leukocyte cell-cell adhesion
GO:0006664	0.816	glycolipid metabolic process
GO:0009311	0.794	oligosaccharide metabolic process
GO:0048518	0.779	positive regulation of biological process
GO:0006487	0.774	protein N-linked glycosylation
GO:0016051	0.724	carbohydrate biosynthetic process
GO:0009312	0.710	oligosaccharide biosynthetic process
GO:0046467	0.673	membrane lipid biosynthetic process
GO:0048522	0.617	positive regulation of cellular process
GO:0006665	0.495	sphingolipid metabolic process
GO:0050896	0.364	response to stimulus
GO:0009247	0.337	glycolipid biosynthetic process
GO:0006687	0.332	glycosphingolipid metabolic process
GO:0006688	0.322	glycosphingolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.998	Golgi apparatus
GO:0098588	0.996	bounding membrane of organelle
GO:0000139	0.954	Golgi membrane
GO:0098791	0.828	Golgi apparatus subcompartment
GO:0005802	0.768	trans-Golgi network
GO:0071944	0.735	cell periphery
GO:0005886	0.556	plasma membrane
GO:0005576	0.301	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:14257	0.865	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = a beta-D-galactosyl-(1->4)-[alpha-L-fucosyl-(1->3)]-N-acetyl-beta-D-glucosaminyl derivative + GDP + H(+)
EC:2.4.1.152	0.865	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase.

[back to server]