StarFunc result for job id P22102

User Input

>input (1010 residues)
MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNTAISISDHTALAQ
FCKEKKIEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIP
TAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAF
GAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAP
QVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQV
ILPLLKSDLYEVIQSTLDGLLCTSLPVWLENHTALTVVMASKGYPGDYTKGVEITGFPEA
QALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLISALEEAKKGLAAIKFEGAIYRKD
VGFRAIAFLQQPRSLTYKESGVDIAAGNMLVKKIQPLAKATSRSGCKVDLGGFAGLFDLK
AAGFKDPLLASGTDGVGTKLKIAQLCNKHDTIGQDLVAMCVNDILAQGAEPLFFLDYFSC
GKLDLSVTEAVVAGIAKACGKAGCALLGGETAEMPDMYPPGEYDLAGFAVGAMERDQKLP
HLERITEGDVVVGIASSGLHSNGFSLVRKIVAKSSLQYSSPAPDGCGDQTLGDLLLTPTR
IYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPRVFSWLQQEG
HLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPRVKVKN
LIESMQINGSVLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV
ISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILS
GPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEA
VPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KGL2	0.429	0.427	0.000	1015	0.600	0.597	A0A0G2KGL2.pdb.gz
2	AFDB:A0A1D8PE67	0.461	0.559	0.000	802	0.371	0.468	A0A1D8PE67.pdb.gz	A0A1D8PE67_CANAL Bifunctional aminoimidazole ribotide synthase/glycinamide ribotide synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADE5:7 PE=3 SV=1
3	AFDB:G3V918	0.715	0.715	0.000	1010	0.865	0.865	G3V918.pdb.gz	G3V918_RAT Trifunctional purine biosynthetic protein adenosine-3 OS=Rattus norvegicus OX=10116 GN=Gart PE=3 SV=1
4	AFDB:G8EWC8	0.622	0.771	0.000	789	0.369	0.473	G8EWC8.pdb.gz	PUR2_PICAN Bifunctional purine biosynthetic protein PUR2,5 OS=Pichia angusta OX=870730 GN=PUR25 PE=1 SV=1
5	AFDB:J9VYP5	0.509	0.609	0.000	802	0.376	0.474	J9VYP5.pdb.gz	PUR2_CRYNH Bifunctional purine biosynthetic protein ADE5,7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=ADE57 PE=1 SV=1
6	AFDB:P00967	0.422	0.317	0.000	1353	0.486	0.363	P00967.pdb.gz	PUR2_DROME Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila melanogaster OX=7227 GN=Gart PE=1 SV=2
7	AFDB:P07244	0.556	0.671	0.000	802	0.355	0.448	P07244.pdb.gz	PUR2_YEAST Bifunctional purine biosynthetic protein ADE5,7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE57 PE=1 SV=1
8	AFDB:P20772	0.639	0.797	0.000	788	0.384	0.492	P20772.pdb.gz	PUR2_SCHPO Bifunctional purine biosynthetic protein ADE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade1 PE=1 SV=1
9	AFDB:P21872	0.939	0.946	0.000	1003	0.744	0.749	P21872.pdb.gz	PUR2_CHICK Trifunctional purine biosynthetic protein adenosine-3 OS=Gallus gallus OX=9031 GN=GART PE=1 SV=1
10	AFDB:P22102	1.000	1.000	0.000	1010	1.000	1.000	P22102.pdb.gz	PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1
11	PDB:1gsoA	0.389	0.905	1.572E-51	419	0.207	0.499	1gsoA.pdb.gz
12	PDB:1cliA	0.327	0.949	2.039E-41	341	0.162	0.481	1cliA.pdb.gz	X-ray crystal structure of aminoimidazole ribonucleotide synthetase (PurM), from the Escherichia coli purine biosynthetic pathway at 2.5 A resolution.
13	PDB:1c2tA	0.193	0.917	7.930E-21	209	0.081	0.392	1c2tA.pdb.gz	New insights into inhibitor design from the crystal structure and NMR studies of Escherichia coli GAR transformylase in complex with beta-GAR and 10-formyl-5,8,10-trideazafolic acid.
14	PDB:3da8A	0.193	0.874	1.094E-19	213	0.070	0.333	3da8A.pdb.gz	Structures of glycinamide ribonucleotide transformylase (PurN) from Mycobacterium tuberculosis reveal a novel dimer with relevance to drug discovery.
15	PDB:1dv2A	0.331	0.679	7.306E-19	450	0.070	0.158	1dv2A.pdb.gz	Movement of the biotin carboxylase B-domain as a result of ATP binding.
16	PDB:7wtbB	0.340	0.302	8.169E-19	1147	0.080	0.071	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.
17	PDB:3bg5A	0.336	0.301	1.333E-17	1137	0.100	0.089	3bg5A.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
18	PDB:5mlkA	0.334	0.688	1.666E-17	451	0.066	0.149	5mlkA.pdb.gz
19	PDB:1eyzA	0.318	0.741	1.863E-17	389	0.072	0.188	1eyzA.pdb.gz	Molecular structure of Escherichia coli PurT-encoded glycinamide ribonucleotide transformylase.
20	PDB:3n6rG	0.286	0.428	5.693E-17	646	0.064	0.101	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PE67	0.0	732	802	0.378	0.476	A0A1D8PE67_CANAL Bifunctional aminoimidazole ribotide synthase/glycinamide ribotide synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADE5:7 PE=3 SV=1
2	B5DEG6	0.0	764	433	0.370	0.864	B5DEG6_RAT phosphoribosylamine--glycine ligase OS=Rattus norvegicus OX=10116 GN=Gart PE=2 SV=1
3	G3V918	0.0	1796	1010	0.865	0.865	G3V918_RAT Trifunctional purine biosynthetic protein adenosine-3 OS=Rattus norvegicus OX=10116 GN=Gart PE=3 SV=1
4	G8EWC8	0.0	735	789	0.370	0.474	PUR2_PICAN Bifunctional purine biosynthetic protein PUR2,5 OS=Pichia angusta OX=870730 GN=PUR25 PE=1 SV=1
5	J9VYP5	0.0	743	802	0.375	0.473	PUR2_CRYNH Bifunctional purine biosynthetic protein ADE5,7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=ADE57 PE=1 SV=1
6	P00967	0.0	650	1353	0.374	0.279	PUR2_DROME Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila melanogaster OX=7227 GN=Gart PE=1 SV=2
7	P07244	0.0	698	802	0.355	0.448	PUR2_YEAST Bifunctional purine biosynthetic protein ADE5,7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE57 PE=1 SV=1
8	P20772	0.0	757	788	0.382	0.490	PUR2_SCHPO Bifunctional purine biosynthetic protein ADE1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade1 PE=1 SV=1
9	P21872	0.0	1545	1003	0.744	0.749	PUR2_CHICK Trifunctional purine biosynthetic protein adenosine-3 OS=Gallus gallus OX=9031 GN=GART PE=1 SV=1
10	P22102	0.0	2064	1010	1.000	1.000	PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1
11	Q5PPK3	0.0	763	433	0.369	0.861	Q5PPK3_RAT phosphoribosylamine--glycine ligase OS=Rattus norvegicus OX=10116 GN=Gart PE=2 SV=1
12	Q64737	0.0	1800	1010	0.859	0.859	PUR2_MOUSE Trifunctional purine biosynthetic protein adenosine-3 OS=Mus musculus OX=10090 GN=Gart PE=1 SV=3
13	Q6FRK3	0.0	713	791	0.363	0.464	Q6FRK3_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H07887g PE=3 SV=1
14	Q9I9E6	0.0	1406	1017	0.672	0.668	Q9I9E6_DANRE Trifunctional purine biosynthetic protein adenosine-3 OS=Danio rerio OX=7955 GN=wu:fb33g04 PE=1 SV=1
15	P15640	7.50e-133	409	429	0.216	0.508	PUR2_ECOLI Phosphoribosylamine--glycine ligase OS=Escherichia coli (strain K12) OX=83333 GN=purD PE=1 SV=2
16	P52420	8.59e-112	358	532	0.198	0.376	PUR2_ARATH Phosphoribosylamine--glycine ligase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PUR2 PE=2 SV=2
17	P08178	6.85e-103	327	345	0.163	0.478	PUR5_ECOLI Phosphoribosylformylglycinamidine cyclo-ligase OS=Escherichia coli (strain K12) OX=83333 GN=purM PE=1 SV=3
18	Q05728	1.74e-97	315	389	0.158	0.411	PUR5_ARATH Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PUR5 PE=1 SV=2
19	Q97TA2	4.79e-97	311	340	0.159	0.474	PUR5_STRPN Phosphoribosylformylglycinamidine cyclo-ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=purM PE=1 SV=1
20	O53823	1.22e-81	271	364	0.152	0.423	O53823_MYCTO Phosphoribosylformylglycinamidine cyclo-ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=purM PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00586 AIRS	5.1e-16	70.4	AIR synthase related protein, N-terminal domain
2	PF02769 AIRS_C	1.1e-36	137.8	AIR synthase related protein, C-terminal domain
3	PF02222 ATP-grasp	0.46	21.6	ATP-grasp domain
4	PF08442 ATP-grasp_2	0.92	20.6	ATP-grasp domain
5	PF02655 ATP-grasp_3	4	19.0	ATP-grasp domain
6	PF13535 ATP-grasp_4	4.1	18.5	ATP-grasp domain
7	PF02786 CPSase_L_D2	0.4	21.7	Carbamoyl-phosphate synthase L chain, ATP binding domain
8	PF07478 Dala_Dala_lig_C	5.9	17.9	D-ala D-ala ligase C-terminus
9	PF04430 DUF498	1.1e+02	14.1	Protein of unknown function (DUF498/DUF598)
10	PF00551 Formyl_trans_N	3.3e-60	214.4	Formyl transferase
11	PF01071 GARS_A	2.7e-88	306.4	Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain
12	PF02843 GARS_C	4.9e-25	99.1	Phosphoribosylglycinamide synthetase, C domain
13	PF02844 GARS_N	7.4e-34	127.9	Phosphoribosylglycinamide synthetase, N domain
14	PF08443 RimK	1.8e+02	13.1	RimK-like ATP-grasp domain
15	PF03435 Sacchrp_dh_NADP	1.1e+02	14.4	Saccharopine dehydrogenase NADP binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371253

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216605	0.999	C-1-tetrahydrofolate synthase, cytoplasmic
2	9606.ENSP00000236959	0.999	Bifunctional purine biosynthesis protein PURH
3	9606.ENSP00000264220	0.999	Amidophosphoribosyltransferase
4	9606.ENSP00000313490	0.999	Phosphoribosylformylglycinamidine synthase
5	9606.ENSP00000318868	0.999	Serine hydroxymethyltransferase, cytosolic
6	9606.ENSP00000382595	0.999	Multifunctional protein ADE2
7	9606.ENSP00000478253	0.999	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
8	9606.ENSP00000333667	0.998	Serine hydroxymethyltransferase, mitochondrial
9	9606.ENSP00000485525	0.996	Adenylosuccinate lyase
10	9606.ENSP00000377617	0.995	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
11	9606.ENSP00000379108	0.993	Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
12	9606.ENSP00000396308	0.993	Dihydrofolate reductase
13	9606.ENSP00000476535	0.987	annotation not available
14	9606.ENSP00000273588	0.965	Aminomethyltransferase, mitochondrial
15	9606.ENSP00000377768	0.962	Dihydrofolate reductase 2, mitochondrial
16	9606.ENSP00000355536	0.957	Methionine synthase
17	9606.ENSP00000258874	0.954	5-formyltetrahydrofolate cyclo-ligase
18	9606.ENSP00000273450	0.954	Cytosolic 10-formyltetrahydrofolate dehydrogenase
19	9606.ENSP00000315644	0.948	Thymidylate synthase
20	9606.ENSP00000419851	0.948	GMP synthase [glutamine-hydrolyzing]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016742	1.000	hydroxymethyl-, formyl- and related transferase activity
GO:0004637	1.000	phosphoribosylamine-glycine ligase activity
GO:0004641	1.000	phosphoribosylformylglycinamidine cyclo-ligase activity
GO:0004644	0.993	phosphoribosylglycinamide formyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0009156	0.994	ribonucleoside monophosphate biosynthetic process
GO:0009117	0.993	nucleotide metabolic process
GO:1901566	0.992	organonitrogen compound biosynthetic process
GO:0009126	0.992	purine nucleoside monophosphate metabolic process
GO:0072521	0.988	purine-containing compound metabolic process
GO:0072522	0.978	purine-containing compound biosynthetic process
GO:0009167	0.970	purine ribonucleoside monophosphate metabolic process
GO:0009152	0.967	purine ribonucleotide biosynthetic process
GO:0046040	0.954	IMP metabolic process
GO:0009168	0.952	purine ribonucleoside monophosphate biosynthetic process
GO:0046033	0.547	AMP metabolic process
GO:0046037	0.525	GMP metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.894	membrane-bounded organelle
GO:0043229	0.654	intracellular organelle
GO:0070013	0.525	intracellular organelle lumen
GO:0043231	0.523	intracellular membrane-bounded organelle
GO:0005576	0.509	extracellular region
GO:0065010	0.448	extracellular membrane-bounded organelle
GO:1903561	0.444	extracellular vesicle
GO:0005615	0.403	extracellular space
GO:0070062	0.366	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17453	1.000	5-phospho-beta-D-ribosylamine + ATP + glycine = ADP + H(+) + N(1)-(5-phospho-beta-D-ribosyl)glycinamide + phosphate
EC:6.3.4.13	1.000	phosphoribosylamine--glycine ligase.
EC:2.1.2.-	1.000	Hydroxymethyl-, formyl- and related transferases.
RHEA:23032	1.000	2-formamido-N(1)-(5-O-phospho-beta-D-ribosyl)acetamidine + ATP = 5-amino-1-(5-phospho-beta-D-ribosyl)imidazole + ADP + H(+) + phosphate
EC:6.3.3.1	1.000	phosphoribosylformylglycinamidine cyclo-ligase.
RHEA:15053	0.993	(6R)-10-formyltetrahydrofolate + N(1)-(5-phospho-beta-D-ribosyl)glycinamide = (6S)-5,6,7,8-tetrahydrofolate + H(+) + N(2)-formyl-N(1)-(5-phospho-beta-D-ribosyl)glycinamide
EC:2.1.2.2	0.993	phosphoribosylglycinamide formyltransferase 1.

[back to server]