StarFunc result for job id P22105

User Input

>input (1400 residues)
MMPAQYALTSSLVLLVLLSTARAGPFSSRSNVTLPAPRPPPQPGGHTVGAGVGSPSSQLY
EHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQ
CTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSP
PSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGVCVCRAGFS
GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCENGRCVCNPG
YTGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCW
PGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCEDGRCV
CWPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR
CMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCED
GVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVC
QDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRG
RCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP
GDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYE
IQFIPTTEGASPPFTARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMI
DGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMP
GVEYVVTVTAERGRAVSYPASVRANTGSSPLGLLGTTDEPPPSGPSTTQGAQAPLLQQRP
QELGELRVLGRDETGRLRVVWTAQPDTFAYFQLRMRVPEGPGAHEEVLPGDVRQALVPPP
PPGTPYELSLHGVPPGGKPSDPIIYQGIMDKDEEKPGKSSGPPRLGELTVTDRTSDSLLL
RWTVPEGEFDSFVIQYKDRDGQPQVVPVEGPQRSAVITSLDPGRKYKFVLYGFVGKKRHG
PLVAEAKILPQSDPSPGTPPHLGNLWVTDPTPDSLHLSWTVPEGQFDTFMVQYRDRDGRP
QVVPVEGPERSFVVSSLDPDHKYRFTLFGIANKKRYGPLTADGTTAPERKEEPPRPEFLE
QPLLGELTVTGVTPDSLRLSWTVAQGPFDSFMVQYKDAQGQPQAVPVAGDENEVTVPGLD
PDRKYKMNLYGLRGRQRVGPESVVAKTAPQEDVDETPSPTELGTEAPESPEEPLLGELTV
TGSSPDSLSLFWTVPQGSFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QYE2	0.120	0.094	0.000	1811	0.351	0.271	F1QYE2.pdb.gz	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
2	AFDB:P24821	0.121	0.087	4.595E-100	2201	0.354	0.225	P24821.pdb.gz	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
3	AFDB:A0A0G2K1L0	0.103	0.078	2.378E-95	2019	0.346	0.240	A0A0G2K1L0.pdb.gz	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
4	AFDB:Q29116	0.143	0.122	7.048E-94	1746	0.331	0.265	Q29116.pdb.gz	TENA_PIG Tenascin OS=Sus scrofa OX=9823 GN=TNC PE=1 SV=1
5	AFDB:Q8BYI9	0.126	0.130	1.567E-57	1358	0.168	0.173	Q8BYI9.pdb.gz	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
6	AFDB:P07589	0.088	0.055	1.233E-39	2478	0.101	0.057	P07589.pdb.gz	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4
7	AFDB:Q62308	0.088	0.130	1.361E-39	860	0.100	0.163	Q62308.pdb.gz	Q62308_MOUSE Tenascin-X (Fragment) OS=Mus musculus OX=10090 GN=Tnxb PE=2 SV=1
8	AFDB:Q8TER0	0.137	0.135	7.591E-39	1413	0.196	0.195	Q8TER0.pdb.gz	SNED1_HUMAN Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNED1 PE=1 SV=2
9	AFDB:B0S602	0.077	0.050	1.446E-37	2480	0.096	0.054	B0S602.pdb.gz	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1
10	AFDB:Q28275	0.133	0.091	4.474E-37	2208	0.088	0.056	Q28275.pdb.gz	FINC_CANLF Fibronectin (Fragment) OS=Canis lupus familiaris OX=9615 GN=FN1 PE=2 SV=3
11	PDB:5a42A	0.094	0.084	4.528E-12	1597	0.051	0.044	5a42A.pdb.gz
12	PDB:7q5zA	0.071	0.073	1.334E-11	1344	0.059	0.062	7q5zA.pdb.gz
13	PDB:6pxvA	0.105	0.161	1.546E-11	823	0.035	0.060	6pxvA.pdb.gz
14	PDB:4ziqA	0.072	0.071	2.075E-11	1450	0.060	0.058	4ziqA.pdb.gz
15	PDB:4lnvA	0.085	0.091	2.405E-11	1276	0.044	0.049	4lnvA.pdb.gz
16	PDB:6h03A	0.063	0.069	6.423E-11	1223	0.049	0.056	6h03A.pdb.gz
17	PDB:1e07A	0.091	0.175	1.802E-10	642	0.054	0.118	1e07A.pdb.gz
18	PDB:5oj2B	0.108	0.163	2.088E-10	692	0.055	0.111	5oj2B.pdb.gz
19	PDB:8eyyA	0.070	0.108	2.088E-10	775	0.036	0.065	8eyyA.pdb.gz
20	PDB:7nycA	0.093	0.087	2.541E-10	1542	0.041	0.037	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1L0	688	2110	0.298	0.198	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
2	A0A571BG59	2336	4114	0.821	0.280	A0A571BG59_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
3	A0A5F8MPH8	1649	4356	0.568	0.183	A0A5F8MPH8_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
4	A0A8I6AG89	688	2019	0.298	0.207	A0A8I6AG89_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
5	A0A8I6AIS3	650	1564	0.286	0.256	A0A8I6AIS3_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
6	A0A8I6ARC1	687	2202	0.298	0.189	A0A8I6ARC1_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
7	A0A8I6GHT4	693	1928	0.296	0.215	A0A8I6GHT4_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
8	A5A8W4	2424	4137	0.861	0.291	A5A8W4_PIG Tenascin XB OS=Sus scrofa OX=9823 GN=TNXB PE=3 SV=1
9	B2LYI9	689	2019	0.308	0.213	B2LYI9_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=2 SV=1
10	E9Q2T3	1998	3126	0.729	0.327	E9Q2T3_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
11	E9QHI1	830	1720	0.351	0.285	E9QHI1_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
12	F1QYE2	717	1811	0.303	0.234	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
13	O18977	2386	4135	0.869	0.294	O18977_BOVIN Tenascin-X OS=Bos taurus OX=9913 GN=TN-X PE=2 SV=1
14	O35452	2333	4006	0.821	0.287	O35452_MOUSE Tenascin X OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
15	O54796	2332	4114	0.821	0.280	O54796_MOUSE Tenascin-X OS=Mus musculus OX=10090 GN=Tnx PE=3 SV=1
16	P22105	2855	4244	1.000	0.330	TENX_HUMAN Tenascin-X OS=Homo sapiens OX=9606 GN=TNXB PE=1 SV=5
17	P24821	672	2201	0.306	0.194	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
18	Q29116	652	1746	0.286	0.230	TENA_PIG Tenascin OS=Sus scrofa OX=9823 GN=TNC PE=1 SV=1
19	Q3V5L4	1999	3126	0.729	0.326	Q3V5L4_MOUSE Tenascin-X OS=Mus musculus OX=10090 GN=Tnxb PE=2 SV=1
20	Q80YX1	696	2110	0.316	0.209	TENA_MOUSE Tenascin OS=Mus musculus OX=10090 GN=Tnc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16389 DUF4998	7.4	17.6	Domain of unknown function
2	PF07974 EGF_2	6.2e-65	226.5	EGF-like domain
3	PF18720 EGF_Tenascin	7.5e-55	193.5	Tenascin EGF domain
4	PF00041 fn3	1e-70	245.4	Fibronectin type III domain
5	PF12661 hEGF	2.3e-06	39.2	Human growth factor-like EGF
6	PF10179 NDNF	0.024	26.1	Neuron-derived neurotrophic factor, first Fn(III) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000018427

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000007666	0.864	Aggrecan
2	9601.ENSPPYP00000001403	0.833	Adhesion G protein-coupled receptor L2
3	9601.ENSPPYP00000010804	0.833	Adhesion G protein-coupled receptor L1
4	9601.ENSPPYP00000016465	0.833	Adhesion G protein-coupled receptor L3
5	9601.ENSPPYP00000010935	0.718	Neurocan
6	9601.ENSPPYP00000018421	0.696	Serine/threonine kinase 19
7	9601.ENSPPYP00000012859	0.642	Collagen, type XVIII, alpha 1
8	9601.ENSPPYP00000017455	0.611	Versican
9	9601.ENSPPYP00000018425	0.548	Cytochrome P450, family 21, subfamily A, polypeptide 2
10	9601.ENSPPYP00000012352	0.544	Syndecan-4
11	9601.ENSPPYP00000017456	0.544	Hyaluronan and proteoglycan link protein 1
12	9601.ENSPPYP00000021836	0.532	Sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1
13	9601.ENSPPYP00000001176	0.524	Protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
14	9601.ENSPPYP00000010654	0.523	Fibrillin 3
15	9601.ENSPPYP00000010896	0.517	Janus kinase 3
16	9601.ENSPPYP00000002453	0.505	Belongs to the integrin alpha chain family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0005539	0.999	glycosaminoglycan binding
GO:1901681	0.996	sulfur compound binding
GO:0008201	0.994	heparin binding
GO:0005518	0.991	collagen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006629	0.985	lipid metabolic process
GO:0019220	0.985	regulation of phosphate metabolic process
GO:0031399	0.985	regulation of protein modification process
GO:0042325	0.984	regulation of phosphorylation
GO:0097435	0.983	supramolecular fiber organization
GO:0043062	0.977	extracellular structure organization
GO:0007155	0.976	cell adhesion
GO:0045229	0.975	external encapsulating structure organization
GO:0030198	0.974	extracellular matrix organization
GO:0007160	0.959	cell-matrix adhesion
GO:0030199	0.957	collagen fibril organization
GO:0043405	0.955	regulation of MAP kinase activity
GO:0006638	0.948	neutral lipid metabolic process
GO:0046486	0.928	glycerolipid metabolic process
GO:0098609	0.905	cell-cell adhesion
GO:0043506	0.889	regulation of JUN kinase activity
GO:0006641	0.869	triglyceride metabolic process
GO:0006082	0.835	organic acid metabolic process
GO:0032787	0.773	monocarboxylic acid metabolic process
GO:0006631	0.764	fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0031012	0.972	extracellular matrix
GO:0005576	0.905	extracellular region
GO:0005615	0.701	extracellular space
GO:0062023	0.625	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]