StarFunc result for job id P22234

User Input

>input (425 residues)
MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKI
TSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYK
FYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSW
LPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVT
SAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQ
DVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKI
RECNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22234	1.000	1.000	3.129E-88	425	1.000	1.000	P22234.pdb.gz	PUR6_HUMAN Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3
2	AFDB:P38024	0.996	0.993	6.461E-78	426	0.859	0.857	P38024.pdb.gz	PUR6_CHICK Multifunctional protein ADE2 OS=Gallus gallus OX=9031 GN=AIRC PE=2 SV=1
3	PDB:7aleA	0.978	0.992	8.277E-78	419	0.986	1.000	7aleA.pdb.gz	Cellular and biochemical validation of a potent PAICS inhibitor
4	AFDB:A0A0A0MPG9	0.996	0.407	1.949E-75	1042	0.784	0.320	A0A0A0MPG9.pdb.gz
5	AFDB:Q9I7S8	0.963	0.954	3.458E-63	429	0.581	0.576	Q9I7S8.pdb.gz	PUR6_DROME Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase OS=Drosophila melanogaster OX=7227 GN=Paics PE=1 SV=2
6	AFDB:Q10457	0.940	0.944	6.244E-58	423	0.489	0.492	Q10457.pdb.gz	PUR6_CAEEL Probable multifunctional protein ADE2 OS=Caenorhabditis elegans OX=6239 GN=pacs-1 PE=1 SV=1
7	AFDB:P0A7D7	0.528	0.933	1.224E-23	237	0.179	0.321	P0A7D7.pdb.gz	PUR7_ECOLI Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Escherichia coli (strain K12) OX=83333 GN=purC PE=1 SV=1
8	PDB:2gqrA	0.526	0.927	3.052E-22	237	0.179	0.321	2gqrA.pdb.gz	Nucleotide Complexes of Escherichia coli Phosphoribosylaminoimidazole Succinocarboxamide Synthetase.
9	AFDB:Q9UUB4	0.510	0.710	1.934E-17	299	0.134	0.191	Q9UUB4.pdb.gz	PUR7_SCHPO Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade7 PE=3 SV=1
10	AFDB:P9WHN1	0.512	0.721	9.036E-17	297	0.127	0.182	P9WHN1.pdb.gz	PUR7_MYCTU Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=purC PE=1 SV=1
11	AFDB:P27616	0.509	0.695	2.831E-16	306	0.129	0.180	P27616.pdb.gz	PUR7_YEAST Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE1 PE=1 SV=2
12	PDB:1obgA	0.492	0.668	1.115E-14	305	0.129	0.180	1obgA.pdb.gz	The Structure of Saicar Synthase: An Enzyme in the De Novo Pathway of Purine Nucleotide Biosynthesis
13	AFDB:P38025	0.502	0.518	1.374E-14	411	0.127	0.131	P38025.pdb.gz	PUR7_ARATH Phosphoribosylaminoimidazole-succinocarboxamide synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PUR7 PE=2 SV=2
14	PDB:2nshA	0.320	0.787	5.732E-10	163	0.094	0.245	2nshA.pdb.gz	N(5)-CAIR Mutase: Role of a CO(2) Binding Site and Substrate Movement in Catalysis.
15	PDB:7jmkD	0.213	0.250	1.325E-5	354	0.106	0.127	7jmkD.pdb.gz	Second distinct conformation of the phosphohistidine loop in succinyl-CoA synthetase
16	PDB:1jkjB	0.240	0.260	2.893E-4	388	0.082	0.090	1jkjB.pdb.gz	Two glutamate residues, Glu 208 alpha and Glu 197 beta, are crucial for phosphorylation and dephosphorylation of the active-site histidine residue in succinyl-CoA synthetase.
17	PDB:3ezxA	0.216	0.403	8.399E-3	212	0.056	0.113	3ezxA.pdb.gz	Structure of Methanosarcina barkeri monomethylamine corrinoid protein
18	PDB:2i2xB	0.221	0.343	8.893E-3	258	0.047	0.078	2i2xB.pdb.gz	Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
19	PDB:4qccA	0.116	0.166	1.183E-2	270	0.066	0.104	4qccA.pdb.gz
20	PDB:4bvuA	0.180	0.372	1.326E-2	171	0.054	0.135	4bvuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22234	0.0	878	425	1.000	1.000	PUR6_HUMAN Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3
2	P38024	0.0	766	426	0.854	0.852	PUR6_CHICK Multifunctional protein ADE2 OS=Gallus gallus OX=9031 GN=AIRC PE=2 SV=1
3	P51583	0.0	858	425	0.962	0.962	PUR6_RAT Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase OS=Rattus norvegicus OX=10116 GN=Paics PE=1 SV=3
4	Q7ZUN6	0.0	727	425	0.784	0.784	Q7ZUN6_DANRE Multifunctional protein ADE2 OS=Danio rerio OX=7955 GN=cb293 PE=1 SV=1
5	Q9I7S8	5.51e-180	510	429	0.584	0.578	PUR6_DROME Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase OS=Drosophila melanogaster OX=7227 GN=Paics PE=1 SV=2
6	Q10457	9.20e-145	421	423	0.487	0.489	PUR6_CAEEL Probable multifunctional protein ADE2 OS=Caenorhabditis elegans OX=6239 GN=pacs-1 PE=1 SV=1
7	P0A7D7	9.35e-28	112	237	0.167	0.300	PUR7_ECOLI Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Escherichia coli (strain K12) OX=83333 GN=purC PE=1 SV=1
8	Q9UUB4	5.36e-09	59.3	299	0.134	0.191	PUR7_SCHPO Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade7 PE=3 SV=1
9	Q84TI2	2.13e-08	58.5	642	0.101	0.067	Q84TI2_ARATH phosphoribosylaminoimidazole carboxylase OS=Arabidopsis thaliana OX=3702 GN=At2g37690 PE=1 SV=1
10	P27616	8.61e-07	52.8	306	0.141	0.196	PUR7_YEAST Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE1 PE=1 SV=2
11	O74197	6.47e-06	50.8	570	0.094	0.070	PUR6_CANGA Phosphoribosylaminoimidazole carboxylase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ADE2 PE=1 SV=2
12	P15567	7.86e-06	50.4	552	0.111	0.085	PUR6_SCHPO Phosphoribosylaminoimidazole carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade6 PE=3 SV=1
13	P0AG18	8.60e-06	48.1	169	0.073	0.183	PURE_ECOLI N5-carboxyaminoimidazole ribonucleotide mutase OS=Escherichia coli (strain K12) OX=83333 GN=purE PE=1 SV=2
14	Q92210	1.29e-05	49.7	568	0.094	0.070	PUR6_CANAL Phosphoribosylaminoimidazole carboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADE2 PE=3 SV=2
15	P21264	4.01e-05	48.1	571	0.099	0.074	PUR6_YEAST Phosphoribosylaminoimidazole carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE2 PE=1 SV=1
16	P9WHN1	4.80e-05	47.4	297	0.111	0.158	PUR7_MYCTU Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=purC PE=1 SV=1
17	C8V449	5.49e-04	44.7	564	0.101	0.076	C8V449_EMENI Phosphoribosylaminoimidazole carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03626 PE=3 SV=1
18	P38025	0.017	39.7	411	0.122	0.127	PUR7_ARATH Phosphoribosylaminoimidazole-succinocarboxamide synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PUR7 PE=2 SV=2
19	A0A1D8PRQ1	0.044	38.1	291	0.125	0.182	A0A1D8PRQ1_CANAL Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADE1 PE=3 SV=1
20	Q38CI1	3.0	32.7	713	0.082	0.049	Q38CI1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7670 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00731 AIRC	1.1e-34	130.6	AIR carboxylase
2	PF01259 SAICAR_synt	2.2e-51	186.4	SAICAR synthetase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000009017

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000011141	0.999	Trifunctional purine biosynthetic protein adenosine-3
2	9555.ENSPANP00000013382	0.997	Adenylosuccinate lyase
3	9555.ENSPANP00000019667	0.993	Phosphoribosylformylglycinamidine synthase
4	9555.ENSPANP00000017345	0.981	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
5	9555.ENSPANP00000011020	0.980	In the C-terminal section
6	9555.ENSPANP00000002788	0.879	Guanine monphosphate synthase
7	9555.ENSPANP00000008990	0.879	Pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
8	9555.ENSPANP00000020366	0.879	Pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
9	9555.ENSPANP00000007030	0.846	Urocanate hydratase 1
10	9555.ENSPANP00000001158	0.845	Propionyl CoA carboxylase, alpha polypeptide
11	9555.ENSPANP00000019762	0.841	Interconversion of serine and glycine.
12	9555.ENSPANP00000001359	0.836	Interconversion of serine and glycine.
13	9555.ENSPANP00000014318	0.831	Iron-responsive element binding protein 2
14	9555.ENSPANP00000019165	0.831	Aconitase 1, soluble
15	9555.ENSPANP00000005869	0.829	Nitrilase 1
16	9555.ENSPANP00000001846	0.820	Fragile histidine triad
17	9555.ENSPANP00000014951	0.798	Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
18	9555.ENSPANP00000017083	0.798	Uncharacterized protein
19	9555.ENSPANP00000013414	0.755	Aconitate hydratase, mitochondrial
20	9555.ENSPANP00000000025	0.750	Chromodomain helicase DNA binding protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0045296	1.000	cadherin binding
GO:0016831	1.000	carboxy-lyase activity
GO:0004639	1.000	phosphoribosylaminoimidazolesuccinocarboxamide synthase activity
GO:0004638	0.828	phosphoribosylaminoimidazole carboxylase activity
GO:0097159	0.318	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0071704	0.958	organic substance metabolic process
GO:0044238	0.955	primary metabolic process
GO:0044237	0.955	cellular metabolic process
GO:0006807	0.941	nitrogen compound metabolic process
GO:0009117	0.861	nucleotide metabolic process
GO:0034654	0.848	nucleobase-containing compound biosynthetic process
GO:1901293	0.843	nucleoside phosphate biosynthetic process
GO:0009165	0.829	nucleotide biosynthetic process
GO:1901564	0.825	organonitrogen compound metabolic process
GO:0072522	0.811	purine-containing compound biosynthetic process
GO:0009259	0.805	ribonucleotide metabolic process
GO:0009260	0.799	ribonucleotide biosynthetic process
GO:0009123	0.723	nucleoside monophosphate metabolic process
GO:0006164	0.707	purine nucleotide biosynthetic process
GO:0009152	0.698	purine ribonucleotide biosynthetic process
GO:0009156	0.679	ribonucleoside monophosphate biosynthetic process
GO:0009127	0.676	purine nucleoside monophosphate biosynthetic process
GO:0009167	0.675	purine ribonucleoside monophosphate metabolic process
GO:0009168	0.664	purine ribonucleoside monophosphate biosynthetic process
GO:0009112	0.585	nucleobase metabolic process
GO:0006144	0.527	purine nucleobase metabolic process
GO:0046037	0.489	GMP metabolic process
GO:0046112	0.397	nucleobase biosynthetic process
GO:0046040	0.337	IMP metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.976	membrane-bounded organelle
GO:0005576	0.974	extracellular region
GO:0016020	0.955	membrane
GO:0070062	0.920	extracellular exosome
GO:0043231	0.844	intracellular membrane-bounded organelle
GO:0005634	0.665	nucleus
GO:0070013	0.606	intracellular organelle lumen
GO:0032991	0.476	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.1.1.-	1.000	Carboxy-lyases.
RHEA:22628	1.000	5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate + ATP + L-aspartate = (2S)-2-[5-amino-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamido]succinate + ADP + 2 H(+) + phosphate
EC:6.3.2.6	1.000	phosphoribosylaminoimidazolesuccinocarboxamide synthase.
RHEA:10792	0.828	5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate + H(+) = 5-amino-1-(5-phospho-beta-D-ribosyl)imidazole + CO2
EC:4.1.1.21	0.828	phosphoribosylaminoimidazole carboxylase.

[back to server]