StarFunc result for job id P22301

User Input

>input (178 residues)
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22301	1.000	1.000	1.207E-25	178	1.000	1.000	P22301.pdb.gz	IL10_HUMAN Interleukin-10 OS=Homo sapiens OX=9606 GN=IL10 PE=1 SV=1
2	PDB:2ilkA	0.831	0.952	9.002E-20	155	0.871	1.000	2ilkA.pdb.gz	Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.
3	AFDB:P29456	0.595	0.595	2.707E-16	178	0.736	0.736	P29456.pdb.gz	IL10_RAT Interleukin-10 OS=Rattus norvegicus OX=10116 GN=Il10 PE=2 SV=1
4	AFDB:P18893	0.583	0.583	2.804E-15	178	0.730	0.730	P18893.pdb.gz	IL10_MOUSE Interleukin-10 OS=Mus musculus OX=10090 GN=Il10 PE=1 SV=2
5	AFDB:P43480	0.583	0.583	4.830E-15	178	0.775	0.775	P43480.pdb.gz	IL10_BOVIN Interleukin-10 OS=Bos taurus OX=9913 GN=IL10 PE=2 SV=2
6	PDB:4x51A	0.710	0.877	5.595E-15	142	0.612	0.768	4x51A.pdb.gz
7	AFDB:Q6A2H4	0.592	0.601	9.929E-10	175	0.444	0.451	Q6A2H4.pdb.gz	IL10_CHICK Interleukin-10 OS=Gallus gallus OX=9031 GN=IL10 PE=2 SV=2
8	PDB:1lqsL	0.472	0.574	2.544E-5	142	0.197	0.246	1lqsL.pdb.gz
9	AFDB:Q9NPH9	0.460	0.477	4.139E-4	171	0.230	0.240	Q9NPH9.pdb.gz	IL26_HUMAN Interleukin-26 OS=Homo sapiens OX=9606 GN=IL26 PE=1 SV=1
10	PDB:4dohA	0.432	0.494	5.537E-3	153	0.191	0.222	4dohA.pdb.gz
11	PDB:6weoQ	0.320	0.387	3.331E-2	142	0.163	0.204	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
12	PDB:6df3C	0.412	0.467	6.753E-2	155	0.163	0.187	6df3C.pdb.gz
13	AFDB:O60784	0.238	0.104	2.821E-1	492	0.135	0.049	O60784.pdb.gz	TOM1_HUMAN Target of Myb1 membrane trafficking protein OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2
14	AFDB:Q75S22	0.308	0.301	3.703E-1	185	0.174	0.168	Q75S22.pdb.gz	Q75S22_DANRE Interferon gamma OS=Danio rerio OX=7955 GN=IFNG PE=2 SV=1
15	AFDB:Q6ZVM7	0.198	0.088	7.927E-1	507	0.129	0.045	Q6ZVM7.pdb.gz	TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2 PE=1 SV=1
16	AFDB:Q8CII8	0.194	0.106	8.370E-1	388	0.146	0.067	Q8CII8.pdb.gz	SYNE4_MOUSE Nesprin-4 OS=Mus musculus OX=10090 GN=Syne4 PE=1 SV=1
17	PDB:7mq8LJ	0.149	0.069	1.763	469	0.129	0.049	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:4cniC	0.351	0.363	1.862	171	0.118	0.123	4cniC.pdb.gz
19	PDB:7u7nD	0.323	0.308	1.966	191	0.107	0.099	7u7nD.pdb.gz
20	PDB:7z0lB	0.369	0.204	2.314	370	0.118	0.057	7z0lB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22301	8.56e-133	370	178	1.000	1.000	IL10_HUMAN Interleukin-10 OS=Homo sapiens OX=9606 GN=IL10 PE=1 SV=1
2	Q6FGW4	8.56e-133	370	178	1.000	1.000	Q6FGW4_HUMAN Interleukin family protein OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
3	Q6FGS9	3.24e-131	366	178	0.994	0.994	Q6FGS9_HUMAN Interleukin family protein (Fragment) OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
4	Q71UZ1	8.93e-119	334	160	0.899	1.000	Q71UZ1_HUMAN Interleukin family protein (Fragment) OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
5	P29456	4.04e-89	260	178	0.736	0.736	IL10_RAT Interleukin-10 OS=Rattus norvegicus OX=10116 GN=Il10 PE=2 SV=1
6	Q29408	3.62e-88	257	177	0.775	0.780	IL10_SHEEP Interleukin-10 OS=Ovis aries OX=9940 GN=IL10 PE=2 SV=1
7	Q6H8Q2	8.05e-88	256	177	0.775	0.780	Q6H8Q2_SHEEP Interleukin family protein OS=Ovis aries OX=9940 GN=il10 PE=3 SV=1
8	P18893	1.14e-87	256	178	0.730	0.730	IL10_MOUSE Interleukin-10 OS=Mus musculus OX=10090 GN=Il10 PE=1 SV=2
9	P43480	2.28e-87	255	178	0.775	0.775	IL10_BOVIN Interleukin-10 OS=Bos taurus OX=9913 GN=IL10 PE=2 SV=2
10	P03180	3.03e-80	237	170	0.792	0.829	IL10H_EBVB9 Viral interleukin-10 homolog OS=Epstein-Barr virus (strain B95-8) OX=10377 GN=BCRF1 PE=1 SV=1
11	Q6A2H4	4.26e-47	153	175	0.416	0.423	IL10_CHICK Interleukin-10 OS=Gallus gallus OX=9031 GN=IL10 PE=2 SV=2
12	Q5EFQ8	5.49e-26	99.8	180	0.275	0.272	Q5EFQ8_DANRE Interleukin family protein OS=Danio rerio OX=7955 GN=zgc:194510 PE=2 SV=2
13	P17150	1.18e-12	64.7	175	0.253	0.257	IL10H_HCMVA Viral interleukin-10 homolog OS=Human cytomegalovirus (strain AD169) OX=10360 GN=UL111A PE=1 SV=2
14	Q6PVS0	2.56e-08	50.1	45	0.230	0.911	Q6PVS0_SHEEP Interleukin family protein (Fragment) OS=Ovis aries OX=9940 GN=IL-10 PE=2 SV=1
15	Q9NPH9	2.92e-07	50.1	171	0.247	0.257	IL26_HUMAN Interleukin-26 OS=Homo sapiens OX=9606 GN=IL26 PE=1 SV=1
16	Q9JKV9	6.71e-06	46.6	176	0.185	0.188	IL20_MOUSE Interleukin-20 OS=Mus musculus OX=10090 GN=Il20 PE=2 SV=1
17	Q9NYY1	3.96e-05	44.3	176	0.242	0.244	IL20_HUMAN Interleukin-20 OS=Homo sapiens OX=9606 GN=IL20 PE=1 SV=2
18	Q9UHD0	3.96e-05	44.3	177	0.152	0.153	IL19_HUMAN Interleukin-19 OS=Homo sapiens OX=9606 GN=IL19 PE=1 SV=2
19	Q198B4	2.10e-04	42.4	172	0.174	0.180	Q198B4_RAT Interleukin-22 (Fragment) OS=Rattus norvegicus OX=10116 GN=Il22 PE=2 SV=1
20	G3V6X6	0.001	40.4	179	0.174	0.173	G3V6X6_RAT Interleukin 22 OS=Rattus norvegicus OX=10116 GN=Il22 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16526 CLZ	5.2e+02	12.4	C-terminal leucine zipper domain of cyclic nucleotide-gated channels
2	PF00726 IL10	5.7e-101	346.6	Interleukin 10
3	PF14565 IL22	0.00028	32.6	Interleukin 22 IL-10-related T-cell-derived-inducible factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412237

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227752	0.999	Interleukin-10 receptor subunit alpha
2	9606.ENSP00000290200	0.999	Interleukin-10 receptor subunit beta
3	9606.ENSP00000398698	0.996	Tumor necrosis factor
4	9606.ENSP00000263341	0.995	Interleukin-1 beta
5	9606.ENSP00000306512	0.994	Interleukin-8
6	9606.ENSP00000344192	0.994	Interleukin-17A
7	9606.ENSP00000225831	0.989	C-C motif chemokine 2
8	9606.ENSP00000280357	0.988	Interleukin-18
9	9606.ENSP00000296871	0.988	Granulocyte-macrophage colony-stimulating factor
10	9606.ENSP00000379110	0.988	Growth-regulated alpha protein
11	9606.ENSP00000477908	0.988	C-C motif chemokine 3
12	9606.ENSP00000482259	0.988	C-C motif chemokine 4
13	9606.ENSP00000263339	0.987	Interleukin-1 alpha
14	9606.ENSP00000332049	0.987	T-lymphocyte activation antigen CD86
15	9606.ENSP00000474412	0.987	C-C motif chemokine 5
16	9606.ENSP00000264246	0.986	T-lymphocyte activation antigen CD80
17	9606.ENSP00000305651	0.986	C-X-C motif chemokine 10
18	9606.ENSP00000225474	0.984	Granulocyte colony-stimulating factor
19	9606.ENSP00000264657	0.984	Signal transducer and activator of transcription 3
20	9606.ENSP00000427279	0.984	C-X-C motif chemokine 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.968	signaling receptor binding
GO:0046983	0.850	protein dimerization activity
GO:0098772	0.648	molecular function regulator activity
GO:0140677	0.531	molecular function activator activity
GO:0030545	0.376	signaling receptor regulator activity
GO:0030546	0.363	signaling receptor activator activity
GO:0048018	0.337	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0001818	0.985	negative regulation of cytokine production
GO:0032642	0.958	regulation of chemokine production
GO:0032652	0.957	regulation of interleukin-1 production
GO:0032677	0.951	regulation of interleukin-8 production
GO:0032675	0.948	regulation of interleukin-6 production
GO:1903555	0.945	regulation of tumor necrosis factor superfamily cytokine production
GO:0032720	0.936	negative regulation of tumor necrosis factor production
GO:0032715	0.906	negative regulation of interleukin-6 production
GO:0050896	0.898	response to stimulus
GO:0032655	0.895	regulation of interleukin-12 production
GO:0050794	0.890	regulation of cellular process
GO:0009987	0.889	cellular process
GO:0048518	0.871	positive regulation of biological process
GO:0051716	0.798	cellular response to stimulus
GO:0048522	0.781	positive regulation of cellular process
GO:0009893	0.751	positive regulation of metabolic process
GO:0032692	0.738	negative regulation of interleukin-1 production
GO:0048583	0.709	regulation of response to stimulus
GO:0010604	0.692	positive regulation of macromolecule metabolic process
GO:0051240	0.645	positive regulation of multicellular organismal process
GO:0048523	0.639	negative regulation of cellular process
GO:0042221	0.633	response to chemical
GO:0051171	0.623	regulation of nitrogen compound metabolic process
GO:0031323	0.613	regulation of cellular metabolic process
GO:0080090	0.602	regulation of primary metabolic process
GO:0002682	0.593	regulation of immune system process
GO:0009605	0.591	response to external stimulus
GO:0070887	0.574	cellular response to chemical stimulus
GO:0010033	0.573	response to organic substance
GO:0032101	0.498	regulation of response to external stimulus
GO:0080134	0.496	regulation of response to stress
GO:0002376	0.493	immune system process
GO:0051173	0.461	positive regulation of nitrogen compound metabolic process
GO:0009607	0.453	response to biotic stimulus
GO:0044419	0.446	biological process involved in interspecies interaction between organisms
GO:0009889	0.440	regulation of biosynthetic process
GO:0051707	0.440	response to other organism
GO:0031326	0.432	regulation of cellular biosynthetic process
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:0010628	0.377	positive regulation of gene expression
GO:0071310	0.376	cellular response to organic substance
GO:0042127	0.367	regulation of cell population proliferation
GO:0006950	0.366	response to stress
GO:0010556	0.348	regulation of macromolecule biosynthetic process
GO:0019219	0.348	regulation of nucleobase-containing compound metabolic process
GO:0007154	0.317	cell communication
GO:0023051	0.310	regulation of signaling
GO:0010646	0.305	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0071944	0.517	cell periphery
GO:0005886	0.512	plasma membrane
GO:0043231	0.474	intracellular membrane-bounded organelle
GO:0005737	0.327	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]