StarFunc result for job id P22307

User Input

>input (547 residues)
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQA
CVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALG
FEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEH
FAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEA
FVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDID
VIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIE
AVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKN
GKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQL
QPGNAKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384NY87	0.972	0.972	0.000	547	1.000	1.000	A0A384NY87.pdb.gz	A0A384NY87_HUMAN Sterol carrier protein 2 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:P11915	0.889	0.889	5.312E-102	547	0.867	0.867	P11915.pdb.gz	SCP2_RAT Sterol carrier protein 2 OS=Rattus norvegicus OX=10116 GN=Scp2 PE=1 SV=3
3	AFDB:P07857	0.842	0.848	1.277E-100	543	0.854	0.860	P07857.pdb.gz	SCP2_BOVIN Sterol carrier protein 2 OS=Bos taurus OX=9913 GN=SCP2 PE=1 SV=2
4	AFDB:G5EDP2	0.733	0.971	6.192E-61	412	0.435	0.578	G5EDP2.pdb.gz	NLTP2_CAEEL Non-specific lipid-transfer protein-like 2 OS=Caenorhabditis elegans OX=6239 GN=daf-22 PE=1 SV=1
5	AFDB:O33332	0.722	0.983	2.308E-60	401	0.448	0.611	O33332.pdb.gz	O33332_MYCTU Probable lipid-transfer protein Ltp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ltp1 PE=1 SV=1
6	AFDB:O06144	0.640	0.859	4.188E-34	402	0.230	0.313	O06144.pdb.gz	O06144_MYCTU Probable nonspecific lipid-transfer protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1627c PE=1 SV=1
7	AFDB:Q57XD5	0.613	0.758	7.238E-30	438	0.212	0.265	Q57XD5.pdb.gz	Q57XD5_TRYB2 3-ketoacyl-CoA thiolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.500 PE=1 SV=1
8	PDB:4bi9C	0.586	0.754	9.418E-28	419	0.208	0.272	4bi9C.pdb.gz
9	AFDB:P71861	0.618	0.859	3.545E-26	386	0.166	0.236	P71861.pdb.gz	P71861_MYCTO Nonspecific lipid-transfer protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3644 PE=4 SV=2
10	AFDB:B0S5C5	0.516	0.694	1.060E-22	397	0.199	0.275	B0S5C5.pdb.gz
11	AFDB:Q8LF48	0.547	0.666	7.223E-22	443	0.161	0.199	Q8LF48.pdb.gz	THIK1_ARATH 3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=KAT1 PE=1 SV=2
12	PDB:4c2kD	0.539	0.726	1.626E-20	399	0.166	0.228	4c2kD.pdb.gz
13	PDB:2iikB	0.542	0.728	1.718E-20	400	0.144	0.198	2iikB.pdb.gz
14	PDB:2wu9A	0.560	0.745	4.868E-20	403	0.144	0.196	2wu9A.pdb.gz
15	PDB:5xyjA	0.524	0.707	1.306E-19	396	0.163	0.225	5xyjA.pdb.gz
16	PDB:6dv2A	0.539	0.673	2.663E-19	432	0.155	0.197	6dv2A.pdb.gz
17	PDB:4wysA	0.534	0.724	2.813E-19	396	0.150	0.207	4wysA.pdb.gz
18	PDB:1wl4A	0.535	0.730	4.129E-19	394	0.154	0.213	1wl4A.pdb.gz	High Resolution Crystal Structures of Human Cytosolic Thiolase (CT): A Comparison of the Active Sites of Human CT, Bacterial Thiolase, and Bacterial KAS I
19	PDB:2ib8D	0.526	0.713	5.141E-19	393	0.172	0.239	2ib8D.pdb.gz	Crystallographic and Kinetic Studies of Human Mitochondrial Acetoacetyl-CoA Thiolase: The Importance of Potassium and Chloride Ions for Its Structure and Function
20	PDB:2d3tC	0.546	0.748	1.457E-18	390	0.141	0.197	2d3tC.pdb.gz	Ligand-Induced Domain Rearrangement of Fatty Acid beta-Oxidation Multienzyme Complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NY87	0.0	1133	547	1.000	1.000	A0A384NY87_HUMAN Sterol carrier protein 2 OS=Homo sapiens OX=9606 PE=2 SV=1
2	P07857	0.0	959	543	0.850	0.856	SCP2_BOVIN Sterol carrier protein 2 OS=Bos taurus OX=9913 GN=SCP2 PE=1 SV=2
3	P11915	0.0	977	547	0.867	0.867	SCP2_RAT Sterol carrier protein 2 OS=Rattus norvegicus OX=10116 GN=Scp2 PE=1 SV=3
4	P22307	0.0	1133	547	1.000	1.000	SCP2_HUMAN Sterol carrier protein 2 OS=Homo sapiens OX=9606 GN=SCP2 PE=1 SV=2
5	P32020	0.0	1007	547	0.892	0.892	SCP2_MOUSE Sterol carrier protein 2 OS=Mus musculus OX=10090 GN=Scp2 PE=1 SV=3
6	O33332	1.30e-178	510	401	0.450	0.613	O33332_MYCTU Probable lipid-transfer protein Ltp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ltp1 PE=1 SV=1
7	H0YCB0	4.07e-170	483	240	0.437	0.996	H0YCB0_HUMAN Sterol carrier protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SCP2 PE=1 SV=2
8	G5EDP2	2.18e-168	485	412	0.435	0.578	NLTP2_CAEEL Non-specific lipid-transfer protein-like 2 OS=Caenorhabditis elegans OX=6239 GN=daf-22 PE=1 SV=1
9	O06144	1.29e-52	186	402	0.239	0.326	O06144_MYCTU Probable nonspecific lipid-transfer protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1627c PE=1 SV=1
10	Q57XD5	5.84e-28	118	438	0.210	0.263	Q57XD5_TRYB2 3-ketoacyl-CoA thiolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.500 PE=1 SV=1
11	Q9NKW1	8.90e-23	103	441	0.115	0.143	MFEA_DICDI Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum OX=44689 GN=mfeA PE=2 SV=1
12	Q8AYH1	4.11e-22	102	725	0.104	0.079	Q8AYH1_DANRE 17-beta-hydroxysteroid dehydrogenase type 4 OS=Danio rerio OX=7955 GN=Dbp PE=1 SV=1
13	P97852	5.37e-20	96.3	735	0.093	0.069	DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus OX=10116 GN=Hsd17b4 PE=1 SV=3
14	P71861	4.08e-19	91.7	386	0.172	0.244	P71861_MYCTO Nonspecific lipid-transfer protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3644 PE=4 SV=2
15	A0A2R8Y7L2	1.48e-17	88.2	589	0.082	0.076	A0A2R8Y7L2_HUMAN Hydroxysteroid 17-beta dehydrogenase 4 OS=Homo sapiens OX=9606 GN=HSD17B4 PE=1 SV=1
16	E7ET17	1.48e-17	88.2	599	0.082	0.075	E7ET17_HUMAN Hydroxysteroid 17-beta dehydrogenase 4 OS=Homo sapiens OX=9606 GN=HSD17B4 PE=1 SV=1
17	A0A0S2Z4J1	1.93e-17	88.2	736	0.082	0.061	A0A0S2Z4J1_HUMAN Epididymis secretory sperm binding protein (Fragment) OS=Homo sapiens OX=9606 GN=HSD17B4 PE=2 SV=1
18	P51659	1.93e-17	88.2	736	0.082	0.061	DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4 PE=1 SV=3
19	P51660	2.13e-17	88.2	735	0.088	0.065	DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus OX=10090 GN=Hsd17b4 PE=1 SV=3
20	Q8BWT1	5.06e-13	73.2	397	0.197	0.272	THIM_MOUSE 3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus OX=10090 GN=Acaa2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08545 ACP_syn_III	0.011	26.9	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III
2	PF14864 Alkyl_sulf_C	0.011	27.4	Alkyl sulfatase C-terminal
3	PF00109 ketoacyl-synt	8.9	17.4	Beta-ketoacyl synthase, N-terminal domain
4	PF02801 Ketoacyl-synt_C	4.7	18.6	Beta-ketoacyl synthase, C-terminal domain
5	PF02036 SCP2	1e-27	107.9	SCP-2 sterol transfer family
6	PF07451 SpoVAD	36	14.6	Stage V sporulation protein AD (SpoVAD)
7	PF02803 Thiolase_C	2.7e-10	51.4	Thiolase, C-terminal domain
8	PF00108 Thiolase_N	3e-22	90.8	Thiolase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360569

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391601	0.996	Peroxisomal targeting signal 1 receptor
2	9606.ENSP00000420914	0.996	Peroxisomal multifunctional enzyme type 2
3	9606.ENSP00000241052	0.994	Catalase
4	9606.ENSP00000369461	0.992	Enoyl-CoA delta isomerase 2, mitochondrial
5	9606.ENSP00000293217	0.989	Peroxisomal acyl-coenzyme A oxidase 1
6	9606.ENSP00000307697	0.988	Peroxisomal acyl-coenzyme A oxidase 2
7	9606.ENSP00000221418	0.973	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
8	9606.ENSP00000231887	0.972	Peroxisomal bifunctional enzyme
9	9606.ENSP00000285737	0.972	Lon protease homolog 2, peroxisomal
10	9606.ENSP00000348775	0.971	Peroxisomal acyl-coenzyme A oxidase 3
11	9606.ENSP00000349016	0.965	Peroxisomal membrane protein PEX14
12	9606.ENSP00000371517	0.960	Alpha-methylacyl-CoA racemase
13	9606.ENSP00000315013	0.959	Carnitine O-acetyltransferase
14	9606.ENSP00000333664	0.959	3-ketoacyl-CoA thiolase, peroxisomal
15	9606.ENSP00000263093	0.957	Bile acyl-CoA synthetase
16	9606.ENSP00000430269	0.951	Bifunctional epoxide hydrolase 2
17	9606.ENSP00000267842	0.948	Very long-chain acyl-CoA synthetase
18	9606.ENSP00000287078	0.944	Peroxisomal leader peptide-processing protease
19	9606.ENSP00000474560	0.943	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
20	9606.ENSP00000355607	0.942	Glyceronephosphate O-acyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0016747	0.998	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0016408	0.994	C-acyltransferase activity
GO:0003988	0.984	acetyl-CoA C-acyltransferase activity
GO:0005319	0.975	lipid transporter activity
GO:0120014	0.955	phospholipid transfer activity
GO:0120020	0.954	cholesterol transfer activity
GO:0042802	0.879	identical protein binding
GO:0019107	0.799	myristoyltransferase activity
GO:0008525	0.438	phosphatidylcholine transporter activity
GO:0050632	0.438	propionyl-CoA C2-trimethyltridecanoyltransferase activity
GO:0044877	0.369	protein-containing complex binding
GO:0016491	0.305	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0050789	0.975	regulation of biological process
GO:0071704	0.969	organic substance metabolic process
GO:0044238	0.966	primary metabolic process
GO:0044237	0.959	cellular metabolic process
GO:1905952	0.945	regulation of lipid localization
GO:0032368	0.938	regulation of lipid transport
GO:0032371	0.934	regulation of sterol transport
GO:1905954	0.925	positive regulation of lipid localization
GO:0032370	0.909	positive regulation of lipid transport
GO:0050794	0.902	regulation of cellular process
GO:0032373	0.899	positive regulation of sterol transport
GO:0010876	0.891	lipid localization
GO:0006629	0.861	lipid metabolic process
GO:0032374	0.860	regulation of cholesterol transport
GO:0006631	0.830	fatty acid metabolic process
GO:0019222	0.793	regulation of metabolic process
GO:0032376	0.733	positive regulation of cholesterol transport
GO:0046395	0.694	carboxylic acid catabolic process
GO:0009062	0.675	fatty acid catabolic process
GO:0019395	0.672	fatty acid oxidation
GO:0006810	0.629	transport
GO:0071702	0.555	organic substance transport
GO:1901360	0.546	organic cyclic compound metabolic process
GO:0006869	0.524	lipid transport
GO:0019216	0.506	regulation of lipid metabolic process
GO:0006635	0.491	fatty acid beta-oxidation
GO:0009058	0.473	biosynthetic process
GO:1901576	0.439	organic substance biosynthetic process
GO:0008202	0.423	steroid metabolic process
GO:1901615	0.411	organic hydroxy compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	1.000	intracellular organelle lumen
GO:0005777	1.000	peroxisome
GO:0005829	0.991	cytosol
GO:0005634	0.985	nucleus
GO:0016020	0.982	membrane
GO:0012505	0.954	endomembrane system
GO:0005654	0.943	nucleoplasm
GO:0005739	0.917	mitochondrion
GO:0005782	0.861	peroxisomal matrix
GO:0005783	0.447	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.998	Transferring groups other than amino-acyl groups.
RHEA:21564	0.984	acetyl-CoA + an acyl-CoA = a 3-oxoacyl-CoA + CoA
EC:2.3.1.16	0.984	acetyl-CoA C-acyltransferase.
RHEA:39747	0.954	cholesterol(in) = cholesterol(out)
RHEA:10408	0.438	4,8,12-trimethyltridecanoyl-CoA + propanoyl-CoA = 3-oxopristanoyl-CoA + CoA
EC:2.3.1.176	0.438	propanoyl-CoA C-acyltransferase.
EC:1.-.-.-	0.305	Oxidoreductases.

[back to server]