StarFunc result for job id P22314

User Input

>input (1058 residues)
MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLY
VLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLRE
EDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCH
NRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARH
GFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKK
ISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVA
LAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPI
MQWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIG
CELLKNFAMIGLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMN
PHIRVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGT
LGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQPA
ENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSN
NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTG
SQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLP
GFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAA
VVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
QGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVS
RVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4ii3A	0.900	0.964	0.000	986	0.511	0.549	4ii3A.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
2	PDB:5l6iA	0.921	0.967	0.000	1007	0.503	0.528	5l6iA.pdb.gz	Dissecting the Specificity of Adenosyl Sulfamate Inhibitors Targeting the Ubiquitin-Activating Enzyme.
3	PDB:6dc6C	0.926	0.983	0.000	996	0.940	0.999	6dc6C.pdb.gz	Crystal structure of a human ubiquitin E1-ubiquitin complex reveals conserved functional elements essential for activity.
4	PDB:7k5jI	0.877	0.946	0.000	979	0.490	0.529	7k5jI.pdb.gz	Crystal structures of an E1-E2-ubiquitin thioester mimetic reveal molecular mechanisms of transthioesterification.
5	PDB:7solA	0.863	0.901	0.000	1011	0.398	0.416	7solA.pdb.gz	Crystal structures reveal catalytic and regulatory mechanisms of the dual-specificity ubiquitin/FAT10 E1 enzyme Uba6.
6	AFDB:A0A024R1A3	0.971	0.971	0.000	1058	1.000	1.000	A0A024R1A3.pdb.gz	A0A024R1A3_HUMAN E1 ubiquitin-activating enzyme OS=Homo sapiens OX=9606 PE=2 SV=1
7	AFDB:A0AVT1	0.877	0.881	0.000	1052	0.409	0.412	A0AVT1.pdb.gz	UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1
8	AFDB:C8VMA9	0.928	0.951	0.000	1033	0.518	0.530	C8VMA9.pdb.gz	C8VMA9_EMENI E1 ubiquitin activating enzyme (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10266 PE=3 SV=1
9	AFDB:F1RCA1	0.958	0.958	0.000	1058	0.790	0.790	F1RCA1.pdb.gz
10	AFDB:O94609	0.925	0.967	0.000	1012	0.516	0.540	O94609.pdb.gz	UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr3 PE=1 SV=1
11	AFDB:P22515	0.937	0.968	0.000	1024	0.507	0.523	P22515.pdb.gz	UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA1 PE=1 SV=2
12	AFDB:P31254	0.956	0.956	0.000	1058	0.846	0.846	P31254.pdb.gz	UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus OX=10090 GN=Uba1y PE=1 SV=2
13	AFDB:P41226	0.893	0.932	0.000	1012	0.444	0.464	P41226.pdb.gz	UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens OX=9606 GN=UBA7 PE=1 SV=2
14	AFDB:P92974	0.928	0.912	0.000	1077	0.454	0.446	P92974.pdb.gz	UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana OX=3702 GN=UBA2 PE=1 SV=1
15	AFDB:P93028	0.931	0.912	0.000	1080	0.440	0.431	P93028.pdb.gz	UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana OX=3702 GN=UBA1 PE=1 SV=1
16	PDB:7pvnB	0.858	0.915	2.092E-103	990	0.403	0.430	7pvnB.pdb.gz	Structures of UBA6 explain its dual specificity for ubiquitin and FAT10.
17	PDB:3kycB	0.302	0.563	3.660E-23	548	0.132	0.255	3kycB.pdb.gz	Active site remodelling accompanies thioester bond formation in the SUMO E1.
18	PDB:6xoiB	0.263	0.670	3.206E-20	403	0.112	0.295	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
19	PDB:1y8rA	0.247	0.792	6.099E-20	314	0.095	0.322	1y8rA.pdb.gz	Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
20	PDB:6cwyD	0.205	0.405	1.000E-19	487	0.124	0.269	6cwyD.pdb.gz	Molecular mechanism of a covalent allosteric inhibitor of SUMO E1 activating enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A024R1A3	2205	1058	1.000	1.000	A0A024R1A3_HUMAN E1 ubiquitin-activating enzyme OS=Homo sapiens OX=9606 PE=2 SV=1
2	A0A0B4KF46	1271	1008	0.583	0.612	A0A0B4KF46_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=1 SV=1
3	A0A8I6A544	1908	1057	0.859	0.860	A0A8I6A544_RAT E1 ubiquitin-activating enzyme OS=Rattus norvegicus OX=10116 GN=Uba1y PE=3 SV=1
4	A0AVT1	783	1052	0.412	0.414	UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1
5	C1P636	961	1112	0.486	0.462	C1P636_CAEEL Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uba-1 PE=1 SV=1
6	C8VMA9	1124	1033	0.525	0.537	C8VMA9_EMENI E1 ubiquitin activating enzyme (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10266 PE=3 SV=1
7	O46111	1261	1008	0.578	0.607	O46111_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=2 SV=1
8	O94609	1108	1012	0.515	0.539	UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr3 PE=1 SV=1
9	P22314	2205	1058	1.000	1.000	UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3
10	P22515	1094	1024	0.511	0.528	UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA1 PE=1 SV=2
11	P31254	1877	1058	0.847	0.847	UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus OX=10090 GN=Uba1y PE=1 SV=2
12	P41226	842	1012	0.447	0.467	UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens OX=9606 GN=UBA7 PE=1 SV=2
13	P92974	928	1077	0.446	0.438	UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana OX=3702 GN=UBA2 PE=1 SV=1
14	P93028	896	1080	0.432	0.423	UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana OX=3702 GN=UBA1 PE=1 SV=1
15	Q02053	2119	1058	0.956	0.956	UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus OX=10090 GN=Uba1 PE=1 SV=1
16	Q27481	961	1113	0.486	0.462	Q27481_CAEEL Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uba-1 PE=1 SV=1
17	Q3S1J5	960	1028	0.486	0.500	Q3S1J5_CAEEL Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uba-1 PE=1 SV=1
18	Q55C16	1065	1017	0.498	0.518	UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1 OS=Dictyostelium discoideum OX=44689 GN=uba1 PE=3 SV=1
19	Q57XC5	643	1055	0.380	0.381	Q57XC5_TRYB2 Ubiquitin-activating enzyme E1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.680 PE=3 SV=1
20	Q5JRR6	871	506	0.396	0.828	Q5JRR6_HUMAN Ubiquitin like modifier activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16191 E1_4HB	5.4e-25	98.6	Ubiquitin-activating enzyme E1 four-helix bundle
2	PF16190 E1_FCCH	1.4e-29	113.3	Ubiquitin-activating enzyme E1 FCCH domain
3	PF09358 E1_UFD	1.3e-31	120.4	Ubiquitin fold domain
4	PF02170 PAZ	3.8e+02	12.6	PAZ domain
5	PF00899 ThiF	8.8e-134	455.1	ThiF family
6	PF10585 UBA_E1_SCCH	1.2e-94	328.5	Ubiquitin-activating enzyme, SCCH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338413

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261427	0.999	Ubiquitin-conjugating enzyme E2 K
2	9606.ENSP00000316176	0.999	Ubiquitin-conjugating enzyme E2 N
3	9606.ENSP00000363019	0.999	Ubiquitin-conjugating enzyme E2 D1
4	9606.ENSP00000381717	0.999	Ubiquitin-conjugating enzyme E2 D2
5	9606.ENSP00000441543	0.999	Polyubiquitin-C
6	9606.ENSP00000215574	0.998	Ubiquitin-conjugating enzyme E2 R1
7	9606.ENSP00000265339	0.998	Ubiquitin-conjugating enzyme E2 B
8	9606.ENSP00000349722	0.998	Ubiquitin conjugating enzyme E2 D3
9	9606.ENSP00000264552	0.997	Ubiquitin-conjugating enzyme E2 S
10	9606.ENSP00000272317	0.997	Ubiquitin-40S ribosomal protein S27a
11	9606.ENSP00000360613	0.997	Ubiquitin-conjugating enzyme E2 A
12	9606.ENSP00000348838	0.996	Ubiquitin-conjugating enzyme E2 C
13	9606.ENSP00000380178	0.996	Ubiquitin-conjugating enzyme E2 G1
14	9606.ENSP00000263228	0.995	Ubiquitin-conjugating enzyme E2 R2
15	9606.ENSP00000303709	0.995	Ubiquitin-conjugating enzyme E2 E1
16	9606.ENSP00000338348	0.994	Ubiquitin-conjugating enzyme E2 G2
17	9606.ENSP00000388107	0.994	Ubiquitin-60S ribosomal protein L40
18	9606.ENSP00000253023	0.993	NEDD8-conjugating enzyme Ubc12
19	9606.ENSP00000347836	0.993	Ubiquitin-conjugating enzyme E2 H
20	9606.ENSP00000222402	0.992	Ubiquitin-conjugating enzyme E2 D4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008641	1.000	ubiquitin-like modifier activating enzyme activity
GO:0005515	0.996	protein binding
GO:0004839	0.983	ubiquitin activating enzyme activity
GO:1901363	0.761	heterocyclic compound binding
GO:0097159	0.750	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0019538	0.994	protein metabolic process
GO:0009987	0.993	cellular process
GO:0043412	0.988	macromolecule modification
GO:0036211	0.946	protein modification process
GO:0070647	0.939	protein modification by small protein conjugation or removal
GO:0032446	0.919	protein modification by small protein conjugation
GO:0016567	0.744	protein ubiquitination
GO:0044237	0.691	cellular metabolic process
GO:0065007	0.619	biological regulation
GO:0050896	0.605	response to stimulus
GO:0050789	0.599	regulation of biological process
GO:0050794	0.523	regulation of cellular process
GO:0051716	0.468	cellular response to stimulus
GO:0006508	0.448	proteolysis
GO:0043632	0.397	modification-dependent macromolecule catabolic process
GO:0051603	0.359	proteolysis involved in protein catabolic process
GO:0019941	0.334	modification-dependent protein catabolic process
GO:0032501	0.330	multicellular organismal process
GO:0032502	0.327	developmental process
GO:0006950	0.323	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.934	cytosol
GO:0032991	0.723	protein-containing complex
GO:0016020	0.528	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.-.-	1.000	Forming carbon-sulfur bonds.
EC:6.2.1.45	0.983	E1 ubiquitin-activating enzyme.

[back to server]