StarFunc result for job id P22413

User Input

>input (925 residues)
MERDGCAGGGSRGGEGGRAPREGPAGNGRDRGRSHAAEAPGDPQAAASLLAPMDVGEEPL
EKAARARTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNC
RCDAACVELGNCCLDYQETCIEPEHIWTCNKFRCGEKRLTRSLCACSDDCKDKGDCCINY
SSVCQGEKSWVEEPCESINEPQCPAGFETPPTLLFSLDGFRAEYLHTWGGLLPVISKLKK
CGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPEW
YKGEPIWVTAKYQGLKSGTFFWPGSDVEINGIFPDIYKMYNGSVPFEERILAVLQWLQLP
KDERPHFYTLYLEEPDSSGHSYGPVSSEVIKALQRVDGMVGMLMDGLKELNLHRCLNLIL
ISDHGMEQGSCKKYIYLNKYLGDVKNIKVIYGPAARLRPSDVPDKYYSFNYEGIARNLSC
REPNQHFKPYLKHFLPKRLHFAKSDRIEPLTFYLDPQWQLALNPSERKYCGSGFHGSDNV
FSNMQALFVGYGPGFKHGIEADTFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPVY
TPKHPKEVHPLVQCPFTRNPRDNLGCSCNPSILPIEDFQTQFNLTVAEEKIIKHETLPYG
RPRVLQKENTICLLSQHQFMSGYSQDILMPLWTSYTVDRNDSFSTEDFSNCLYQDFRIPL
SPVHKCSFYKNNTKVSYGFLSPPQLNKNSSGIYSEALLTTNIVPMYQSFQVIWRYFHDTL
LRKYAEERNGVNVVSGPVFDFDYDGRCDSLENLRQKRRVIRNQEILIPTHFFIVLTSCKD
TSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDSSWVEELLMLHRARITDVEHITGLSF
YQQRKEPVSDILKLKTHLPTFSQED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4b56A	0.799	0.903	0.000	816	0.705	0.799	4b56A.pdb.gz	Structure of Npp1, an Ectonucleotide Pyrophosphatase/Phosphodiesterase Involved in Tissue Calcification.
2	PDB:6c01A	0.843	0.950	0.000	819	0.486	0.549	6c01A.pdb.gz	Structural basis for nucleotide recognition by the ectoenzyme CD203c.
3	PDB:6wevAbA	0.882	0.999	0.000	817	0.883	1.000	6wevAbA.pdb.gz	Crystal structures of human ENPP1 in apo and bound forms.
4	PDB:6xkdB	0.731	0.992	0.000	681	0.598	0.812	6xkdB.pdb.gz	Structure-Aided Development of Small-Molecule Inhibitors of ENPP1, the Extracellular Phosphodiesterase of the Immunotransmitter cGAMP.
5	AFDB:B0JZL7	0.837	0.880	0.000	878	0.512	0.540	B0JZL7.pdb.gz	B0JZL7_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Danio rerio OX=7955 GN=si:ch211-142e24.2 PE=1 SV=1
6	AFDB:O14638	0.851	0.899	0.000	875	0.494	0.522	O14638.pdb.gz	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
7	AFDB:P06802	0.937	0.956	0.000	906	0.788	0.805	P06802.pdb.gz	ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus OX=10090 GN=Enpp1 PE=1 SV=4
8	AFDB:P22413	1.000	1.000	0.000	925	1.000	1.000	P22413.pdb.gz	ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2
9	AFDB:P97675	0.851	0.899	0.000	875	0.475	0.502	P97675.pdb.gz	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
10	AFDB:E2RUH0	0.773	0.831	2.773E-103	859	0.412	0.444	E2RUH0.pdb.gz	E2RUH0_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2, long form OS=Gallus gallus OX=9031 GN=Enpp2 PE=2 SV=1
11	AFDB:Q6PGY9	0.777	0.844	1.984E-102	850	0.402	0.438	Q6PGY9.pdb.gz	Q6PGY9_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 2 OS=Danio rerio OX=7955 GN=atx PE=2 SV=1
12	PDB:6g4gD	0.779	0.916	1.695E-101	781	0.448	0.530	6g4gD.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
13	AFDB:Q64610	0.779	0.811	1.990E-101	887	0.423	0.441	Q64610.pdb.gz	ENPP2_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Rattus norvegicus OX=10116 GN=Enpp2 PE=1 SV=2
14	AFDB:Q13822	0.780	0.835	3.908E-101	863	0.416	0.446	Q13822.pdb.gz	ENPP2_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Homo sapiens OX=9606 GN=ENPP2 PE=1 SV=3
15	PDB:6g4gC	0.753	0.932	3.746E-99	742	0.439	0.547	6g4gC.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
16	PDB:5s9mA	0.779	0.887	1.090E-98	809	0.411	0.470	5s9mA.pdb.gz	Crystal Structure of a rat Autotaxin complex
17	PDB:6g4gB	0.761	0.922	4.204E-98	759	0.425	0.518	6g4gB.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
18	PDB:3wayA	0.764	0.895	8.254E-98	787	0.408	0.479	3wayA.pdb.gz	Screening and X-ray Crystal Structure-based Optimization of Autotaxin (ENPP2) Inhibitors, Using a Newly Developed Fluorescence Probe
19	AFDB:P84039	0.401	0.765	1.519E-39	477	0.150	0.291	P84039.pdb.gz	ENPP5_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Rattus norvegicus OX=10116 GN=Enpp5 PE=1 SV=2
20	PDB:5venA	0.395	0.937	4.987E-39	382	0.146	0.353	5venA.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0JZL7	0.0	940	878	0.492	0.518	B0JZL7_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Danio rerio OX=7955 GN=si:ch211-142e24.2 PE=1 SV=1
2	B2RBY8	0.0	1818	873	0.943	0.999	B2RBY8_HUMAN cDNA, FLJ95771, highly similar to Homo sapiens ectonucleotide pyrophosphatase/phosphodiesterase 1 (ENPP1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
3	E2RUH0	0.0	772	859	0.415	0.447	E2RUH0_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2, long form OS=Gallus gallus OX=9031 GN=Enpp2 PE=2 SV=1
4	O14638	0.0	937	875	0.499	0.528	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
5	P06802	0.0	1540	906	0.788	0.805	ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus OX=10090 GN=Enpp1 PE=1 SV=4
6	P22413	0.0	1931	925	1.000	1.000	ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2
7	P97675	0.0	906	875	0.464	0.490	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
8	Q13822	0.0	751	863	0.406	0.436	ENPP2_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Homo sapiens OX=9606 GN=ENPP2 PE=1 SV=3
9	Q64610	0.0	763	887	0.417	0.435	ENPP2_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Rattus norvegicus OX=10116 GN=Enpp2 PE=1 SV=2
10	Q6DYE8	0.0	905	874	0.472	0.500	ENPP3_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Mus musculus OX=10090 GN=Enpp3 PE=1 SV=2
11	Q6PGY9	0.0	764	850	0.405	0.441	Q6PGY9_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 2 OS=Danio rerio OX=7955 GN=atx PE=2 SV=1
12	Q924C3	0.0	1534	906	0.784	0.800	ENPP1_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Rattus norvegicus OX=10116 GN=Enpp1 PE=1 SV=2
13	Q9R1E6	0.0	764	862	0.412	0.442	ENPP2_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Mus musculus OX=10090 GN=Enpp2 PE=1 SV=3
14	E2RUH1	2.92e-101	322	372	0.163	0.406	E2RUH1_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2 OS=Gallus gallus OX=9031 GN=Enpp2 PE=1 SV=1
15	Q9SU83	1.18e-82	277	496	0.169	0.315	Q9SU83_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29680 PE=1 SV=1
16	Q9SU81	5.10e-72	247	461	0.174	0.349	Q9SU81_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29700 PE=1 SV=1
17	Q9Y6X5	5.20e-72	247	453	0.162	0.331	ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3
18	Q9EQG7	6.41e-72	247	477	0.150	0.291	ENPP5_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Mus musculus OX=10090 GN=Enpp5 PE=1 SV=3
19	P84039	4.42e-70	242	477	0.151	0.294	ENPP5_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Rattus norvegicus OX=10116 GN=Enpp5 PE=1 SV=2
20	Q9UJA9	2.45e-69	240	477	0.146	0.283	ENPP5_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Homo sapiens OX=9606 GN=ENPP5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01223 Endonuclease_NS	9.6e-07	40.4	DNA/RNA non-specific endonuclease
2	PF01676 Metalloenzyme	2.4e+02	12.5	Metalloenzyme superfamily
3	PF01663 Phosphodiest	1.9e-87	305.8	Type I phosphodiesterase / nucleotide pyrophosphatase
4	PF01033 Somatomedin_B	1.5e-11	55.8	Somatomedin B domain
5	PF00884 Sulfatase	1.7	19.6	Sulfatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354238

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363973	0.968	Alkaline phosphatase, tissue-nonspecific isozyme
2	9606.ENSP00000301825	0.965	Ectonucleoside triphosphate diphosphohydrolase 3
3	9606.ENSP00000360561	0.963	Ectonucleoside triphosphate diphosphohydrolase 8
4	9606.ENSP00000360250	0.962	Ectonucleoside triphosphate diphosphohydrolase 1
5	9606.ENSP00000335246	0.953	Ectonucleoside triphosphate diphosphohydrolase 5
6	9606.ENSP00000468767	0.946	Tartrate-resistant acid phosphatase type 5
7	9606.ENSP00000226284	0.941	Bone sialoprotein 2
8	9606.ENSP00000365840	0.936	Ectonucleoside triphosphate diphosphohydrolase 6
9	9606.ENSP00000256997	0.934	Acid phosphatase 2, lysosomal
10	9606.ENSP00000430075	0.934	AMP deaminase 1
11	9606.ENSP00000256578	0.932	AMP deaminase 2
12	9606.ENSP00000164139	0.929	Glycogen phosphorylase, muscle form
13	9606.ENSP00000265016	0.929	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
14	9606.ENSP00000226279	0.924	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
15	9606.ENSP00000286621	0.923	Adenosine kinase
16	9606.ENSP00000294724	0.917	Glycogen debranching enzyme
17	9606.ENSP00000379802	0.917	AMP deaminase 3
18	9606.ENSP00000216392	0.916	Glycogen phosphorylase, liver form
19	9606.ENSP00000365926	0.916	Riboflavin kinase
20	9606.ENSP00000307674	0.914	Soluble calcium-activated nucleotidase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043167	0.999	ion binding
GO:0005515	0.999	protein binding
GO:0008081	0.999	phosphoric diester hydrolase activity
GO:0004527	0.999	exonuclease activity
GO:0047429	0.996	nucleoside triphosphate diphosphatase activity
GO:0004528	0.994	phosphodiesterase I activity
GO:0043169	0.929	cation binding
GO:0046872	0.909	metal ion binding
GO:0005509	0.877	calcium ion binding
GO:0046914	0.875	transition metal ion binding
GO:0008270	0.864	zinc ion binding
GO:0042802	0.726	identical protein binding
GO:0016791	0.701	phosphatase activity
GO:0004551	0.689	dinucleotide phosphatase activity
GO:0046983	0.589	protein dimerization activity
GO:0042803	0.571	protein homodimerization activity
GO:0097159	0.501	organic cyclic compound binding
GO:1901363	0.497	heterocyclic compound binding
GO:0097367	0.473	carbohydrate derivative binding
GO:0000166	0.396	nucleotide binding
GO:0043168	0.355	anion binding
GO:0030554	0.341	adenyl nucleotide binding
GO:0032559	0.320	adenyl ribonucleotide binding
GO:0005524	0.304	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006793	0.984	phosphorus metabolic process
GO:0044281	0.982	small molecule metabolic process
GO:1901360	0.980	organic cyclic compound metabolic process
GO:1901135	0.979	carbohydrate derivative metabolic process
GO:0006807	0.976	nitrogen compound metabolic process
GO:0006753	0.966	nucleoside phosphate metabolic process
GO:0009117	0.960	nucleotide metabolic process
GO:0072521	0.952	purine-containing compound metabolic process
GO:0006163	0.911	purine nucleotide metabolic process
GO:0019693	0.907	ribose phosphate metabolic process
GO:0065007	0.861	biological regulation
GO:0050789	0.822	regulation of biological process
GO:0009259	0.812	ribonucleotide metabolic process
GO:0032501	0.744	multicellular organismal process
GO:0050896	0.690	response to stimulus
GO:0009150	0.655	purine ribonucleotide metabolic process
GO:0050794	0.623	regulation of cellular process
GO:0009141	0.572	nucleoside triphosphate metabolic process
GO:0051716	0.400	cellular response to stimulus
GO:0009199	0.362	ribonucleoside triphosphate metabolic process
GO:0009144	0.340	purine nucleoside triphosphate metabolic process
GO:0032502	0.325	developmental process
GO:0042221	0.306	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005576	0.998	extracellular region
GO:0005886	0.998	plasma membrane
GO:0043227	0.997	membrane-bounded organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005615	0.992	extracellular space
GO:0009986	0.924	cell surface
GO:0005829	0.922	cytosol
GO:0031090	0.838	organelle membrane
GO:0098588	0.741	bounding membrane of organelle
GO:0000323	0.734	lytic vacuole
GO:0005774	0.722	vacuolar membrane
GO:0005765	0.711	lysosomal membrane
GO:0031982	0.643	vesicle
GO:0043230	0.602	extracellular organelle
GO:0065010	0.589	extracellular membrane-bounded organelle
GO:0070013	0.554	intracellular organelle lumen
GO:1903561	0.526	extracellular vesicle
GO:0070062	0.524	extracellular exosome
GO:0012505	0.474	endomembrane system
GO:0005634	0.301	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	0.999	Phosphoric diester hydrolases.
EC:3.6.1.9	0.996	nucleotide diphosphatase.
EC:3.1.4.1	0.994	phosphodiesterase I.
EC:3.1.3.-	0.701	Phosphoric monoester hydrolases.

[back to server]