StarFunc result for job id P22466

User Input

>input (123 residues)
MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGL
TSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDI
ERS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22466	1.000	1.000	4.131E-19	123	1.000	1.000	P22466.pdb.gz	GALA_HUMAN Galanin peptides OS=Homo sapiens OX=9606 GN=GAL PE=1 SV=3
2	AFDB:P07480	0.344	0.344	1.765E-10	123	0.724	0.724	P07480.pdb.gz	GALA_PIG Galanin peptides OS=Sus scrofa OX=9823 GN=GAL PE=1 SV=1
3	AFDB:P10683	0.366	0.364	4.136E-10	124	0.699	0.694	P10683.pdb.gz	GALA_RAT Galanin peptides OS=Rattus norvegicus OX=10116 GN=Gal PE=1 SV=1
4	AFDB:E7EZ53	0.257	0.266	6.910E-6	118	0.488	0.508	E7EZ53.pdb.gz	GALA_DANRE Galanin peptides OS=Danio rerio OX=7955 GN=gal PE=1 SV=1
5	PDB:7wtxt	0.164	0.155	1.467	132	0.130	0.121	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
6	AFDB:Q9BUV0	0.172	0.090	1.486	290	0.154	0.066	Q9BUV0.pdb.gz	RSRP1_HUMAN Arginine/serine-rich protein 1 OS=Homo sapiens OX=9606 GN=RSRP1 PE=1 SV=2
7	AFDB:Q6NS45	0.178	0.040	3.244	935	0.179	0.024	Q6NS45.pdb.gz	CCD66_MOUSE Coiled-coil domain-containing protein 66 OS=Mus musculus OX=10090 GN=Ccdc66 PE=1 SV=3
8	AFDB:P0CU08	0.206	0.142	3.483	235	0.122	0.064	P0CU08.pdb.gz	GEMI2_SCHPO SMN complex subunit yip11/gem2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yip11 PE=1 SV=1
9	AFDB:Q8I0G7	0.218	0.092	4.309	342	0.171	0.061	Q8I0G7.pdb.gz	Q8I0G7_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1400300 PE=4 SV=1
10	AFDB:Q8IJ06	0.192	0.070	4.309	378	0.163	0.053	Q8IJ06.pdb.gz	Q8IJ06_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1040300 PE=1 SV=1
11	AFDB:A2RUB6	0.176	0.040	4.626	948	0.171	0.022	A2RUB6.pdb.gz	CCD66_HUMAN Coiled-coil domain-containing protein 66 OS=Homo sapiens OX=9606 GN=CCDC66 PE=1 SV=4
12	PDB:7t3aM	0.167	0.177	4.901	115	0.146	0.157	7t3aM.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
13	PDB:3pcoC	0.144	0.080	5.649	323	0.106	0.040	3pcoC.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
14	PDB:1lnwB	0.151	0.141	8.055	139	0.114	0.101	1lnwB.pdb.gz
15	PDB:8eaue	0.167	0.231	8.647	72	0.098	0.167	8eaue.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22466	3.04e-84	243	123	1.000	1.000	GALA_HUMAN Galanin peptides OS=Homo sapiens OX=9606 GN=GAL PE=1 SV=3
2	P47212	1.02e-55	171	124	0.707	0.702	GALA_MOUSE Galanin peptides OS=Mus musculus OX=10090 GN=Gal PE=1 SV=1
3	P10683	1.55e-52	163	124	0.699	0.694	GALA_RAT Galanin peptides OS=Rattus norvegicus OX=10116 GN=Gal PE=1 SV=1
4	P07480	1.18e-46	148	123	0.724	0.724	GALA_PIG Galanin peptides OS=Sus scrofa OX=9823 GN=GAL PE=1 SV=1
5	E7EZ53	3.45e-35	119	118	0.496	0.517	GALA_DANRE Galanin peptides OS=Danio rerio OX=7955 GN=gal PE=1 SV=1
6	Q810H5	0.022	34.7	117	0.163	0.171	GALP_MOUSE Galanin-like peptide OS=Mus musculus OX=10090 GN=Galp PE=2 SV=1
7	Q9QXQ6	0.028	34.3	115	0.163	0.174	GALP_RAT Galanin-like peptide OS=Rattus norvegicus OX=10116 GN=Galp PE=3 SV=1
8	Q9UBC7	0.049	33.9	116	0.179	0.190	GALP_HUMAN Galanin-like peptide OS=Homo sapiens OX=9606 GN=GALP PE=1 SV=1
9	Q56975	0.073	34.3	419	0.171	0.050	Q56975_YERPE Type III secretion protein OS=Yersinia pestis OX=632 GN=yscD PE=1 SV=1
10	Q9LFD5	2.0	30.0	259	0.089	0.042	BPA1_ARATH Binding partner of ACD11 1 OS=Arabidopsis thaliana OX=3702 GN=BPA1 PE=1 SV=1
11	Q380Z0	5.8	28.5	303	0.138	0.056	Q380Z0_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8740 PE=3 SV=1
12	Q27787	5.9	28.5	303	0.138	0.056	Q27787_9TRYP Serine/threonine-protein phosphatase OS=Trypanosoma brucei OX=5691 PE=2 SV=1
13	P48482	7.3	28.5	312	0.106	0.042	PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana OX=3702 GN=TOPP2 PE=1 SV=1
14	P48484	9.8	28.1	321	0.106	0.040	PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana OX=3702 GN=TOPP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01296 Galanin	1.1e-15	68.6	Galanin
2	PF06540 GMAP	1.4e-29	113.3	Galanin message associated peptide (GMAP)
3	PF05887 Trypan_PARP	5.9e+02	11.8	Procyclic acidic repetitive protein (PARP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329684	0.999	Galanin receptor type 2
2	9606.ENSP00000299727	0.998	Galanin receptor type 1
3	9606.ENSP00000249041	0.997	Galanin receptor type 3
4	9606.ENSP00000384364	0.954	Pro-neuropeptide Y
5	9606.ENSP00000321106	0.885	Protachykinin-1
6	9606.ENSP00000379472	0.841	Cholecystokinin
7	9606.ENSP00000331746	0.829	Calcitonin
8	9606.ENSP00000256010	0.827	Neurotensin/neuromedin N
9	9606.ENSP00000356213	0.813	VIP peptides
10	9606.ENSP00000287641	0.812	Somatostatin
11	9606.ENSP00000349884	0.804	Galanin-like peptide
12	9606.ENSP00000316244	0.786	5-hydroxytryptamine receptor 1A
13	9606.ENSP00000293330	0.773	Orexin
14	9606.ENSP00000328230	0.767	Free fatty acid receptor 3
15	9606.ENSP00000473212	0.767	G-protein coupled receptor 42
16	9606.ENSP00000246553	0.765	Free fatty acid receptor 1
17	9606.ENSP00000370571	0.754	Tyrosine 3-monooxygenase
18	9606.ENSP00000217386	0.753	Oxytocin-neurophysin 1
19	9606.ENSP00000440185	0.747	Proenkephalin-B
20	9606.ENSP00000473159	0.740	Free fatty acid receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001664	1.000	G protein-coupled receptor binding
GO:0005179	0.998	hormone activity
GO:0004930	0.997	G protein-coupled receptor activity
GO:0005184	0.993	neuropeptide hormone activity
GO:0071855	0.992	neuropeptide receptor binding
GO:0008188	0.992	neuropeptide receptor activity
GO:0031766	0.943	type 3 galanin receptor binding
GO:0031765	0.943	type 2 galanin receptor binding
GO:0004966	0.942	galanin receptor activity
GO:0031764	0.941	type 1 galanin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050896	0.990	response to stimulus
GO:0007154	0.988	cell communication
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.977	cellular response to stimulus
GO:0007165	0.974	signal transduction
GO:0048518	0.907	positive regulation of biological process
GO:0048522	0.895	positive regulation of cellular process
GO:0065008	0.888	regulation of biological quality
GO:0010646	0.846	regulation of cell communication
GO:0023051	0.840	regulation of signaling
GO:0032879	0.838	regulation of localization
GO:0019222	0.801	regulation of metabolic process
GO:0051239	0.798	regulation of multicellular organismal process
GO:0010647	0.786	positive regulation of cell communication
GO:0023056	0.776	positive regulation of signaling
GO:1903532	0.728	positive regulation of secretion by cell
GO:0046883	0.699	regulation of hormone secretion
GO:0080090	0.659	regulation of primary metabolic process
GO:0031323	0.555	regulation of cellular metabolic process
GO:0046887	0.545	positive regulation of hormone secretion
GO:0060255	0.534	regulation of macromolecule metabolic process
GO:0034762	0.465	regulation of transmembrane transport
GO:0032501	0.458	multicellular organismal process
GO:0007186	0.449	G protein-coupled receptor signaling pathway
GO:0009893	0.444	positive regulation of metabolic process
GO:0065009	0.426	regulation of molecular function
GO:0051171	0.411	regulation of nitrogen compound metabolic process
GO:0048519	0.380	negative regulation of biological process
GO:0031325	0.307	positive regulation of cellular metabolic process
GO:0032409	0.306	regulation of transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.930	extracellular space
GO:0044297	0.892	cell body
GO:0036477	0.889	somatodendritic compartment
GO:0016020	0.834	membrane
GO:0005622	0.736	intracellular anatomical structure
GO:0043025	0.726	neuronal cell body
GO:0043226	0.697	organelle
GO:0043227	0.609	membrane-bounded organelle
GO:0012505	0.471	endomembrane system
GO:0043229	0.412	intracellular organelle
GO:0005737	0.399	cytoplasm
GO:0043231	0.333	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]