StarFunc result for job id P22557

User Input

>input (587 residues)
MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGG
DSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFKTDLPSSLVSVSLRKPFSGPQ
EQEQISGKVTHLIQNNMPGNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQH
FSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELE
QELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKF
VFRHNDPDHLKKLLEKSNPKIPKIVAFETVHSMDGAICPLEELCDVSHQYGALTFVDEVH
AVGLYGSRGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFT
TSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRV
GNAALNSKLCDLLLSKHGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAW
TAVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08680	0.748	0.748	1.444E-97	587	0.901	0.901	P08680.pdb.gz	HEM0_MOUSE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Mus musculus OX=10090 GN=Alas2 PE=1 SV=3
2	AFDB:Q9YHT4	0.721	0.726	2.065E-77	583	0.649	0.654	Q9YHT4.pdb.gz	HEM0_DANRE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Danio rerio OX=7955 GN=alas2 PE=2 SV=1
3	AFDB:Q7T2F0	0.747	0.716	2.018E-76	613	0.608	0.582	Q7T2F0.pdb.gz	Q7T2F0_DANRE 5-aminolevulinate synthase OS=Danio rerio OX=7955 GN=wu:fb58d01 PE=1 SV=1
4	AFDB:P13195	0.728	0.667	2.451E-75	642	0.627	0.573	P13195.pdb.gz	HEM1_RAT 5-aminolevulinate synthase, non-specific, mitochondrial OS=Rattus norvegicus OX=10116 GN=Alas1 PE=2 SV=2
5	AFDB:P07997	0.721	0.667	3.395E-75	635	0.625	0.578	P07997.pdb.gz	HEM1_CHICK 5-aminolevulinate synthase, non-specific, mitochondrial OS=Gallus gallus OX=9031 GN=ALAS1 PE=1 SV=2
6	AFDB:O18680	0.697	0.758	5.022E-66	539	0.482	0.525	O18680.pdb.gz	O18680_DROME 5-aminolevulinate synthase OS=Drosophila melanogaster OX=7227 GN=Alas PE=2 SV=1
7	AFDB:P18080	0.744	0.850	3.544E-65	513	0.484	0.554	P18080.pdb.gz	HEM0_CHICK 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Gallus gallus OX=9031 GN=ALAS2 PE=2 SV=2
8	AFDB:A2R9H8	0.666	0.604	3.668E-57	649	0.394	0.356	A2R9H8.pdb.gz	A2R9H8_ASPNC 5-aminolevulinate synthase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An17g01480 PE=3 SV=1
9	AFDB:O14092	0.674	0.709	6.877E-56	558	0.359	0.378	O14092.pdb.gz	HEM1_SCHPO 5-aminolevulinate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hem1 PE=3 SV=1
10	AFDB:O94069	0.668	0.695	3.617E-54	564	0.361	0.376	O94069.pdb.gz	HEM1_CANAL 5-aminolevulinate synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HEM1 PE=3 SV=2
11	PDB:5txrA	0.660	0.807	1.167E-48	479	0.319	0.390	5txrA.pdb.gz	Structure of the Mitochondrial Aminolevulinic Acid Synthase, a Key Heme Biosynthetic Enzyme.
12	PDB:7poaA	0.641	0.936	4.625E-37	398	0.208	0.307	7poaA.pdb.gz	An Irreversible, Promiscuous and Highly Thermostable Claisen-Condensation Biocatalyst Drives the Synthesis of Substituted Pyrroles
13	PDB:1fc4A	0.627	0.907	6.763E-37	401	0.211	0.309	1fc4A.pdb.gz	Three-dimensional structure of 2-amino-3-ketobutyrate CoA ligase from Escherichia coli complexed with a PLP-substrate intermediate: inferred reaction mechanism.
14	PDB:1dj9A	0.605	0.913	3.556E-35	383	0.199	0.305	1dj9A.pdb.gz	Mechanism of 8-amino-7-oxononanoate synthase: spectroscopic, kinetic, and crystallographic studies.
15	PDB:7cqiT	0.619	0.724	1.603E-31	498	0.187	0.221	7cqiT.pdb.gz	Structural insights into the assembly and substrate selectivity of human SPT-ORMDL3 complex.
16	PDB:7k0mA	0.565	0.708	8.898E-30	464	0.157	0.198	7k0mA.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
17	PDB:5eudA	0.473	0.597	7.205E-16	454	0.101	0.130	5eudA.pdb.gz	Creation of a S1P Lyase bacterial surrogate for structure-based drug design.
18	PDB:3ntjB	0.485	0.691	1.382E-15	393	0.106	0.158	3ntjB.pdb.gz
19	PDB:2hufA	0.464	0.674	1.626E-15	385	0.116	0.177	2hufA.pdb.gz	Crystal Structures of Aedes aegypti Alanine Glyoxylate Aminotransferase.
20	PDB:3f9tA	0.473	0.681	1.914E-15	394	0.111	0.165	3f9tA.pdb.gz	Crystal structure of L-tyrosine decarboxylase MfnA (EC 4.1.1.25) (NP_247014.1) from METHANOCOCCUS JANNASCHII at 2.11 A resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O18680	0.0	556	539	0.475	0.518	O18680_DROME 5-aminolevulinate synthase OS=Drosophila melanogaster OX=7227 GN=Alas PE=2 SV=1
2	P07997	0.0	707	635	0.603	0.557	HEM1_CHICK 5-aminolevulinate synthase, non-specific, mitochondrial OS=Gallus gallus OX=9031 GN=ALAS1 PE=1 SV=2
3	P08680	0.0	1111	587	0.901	0.901	HEM0_MOUSE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Mus musculus OX=10090 GN=Alas2 PE=1 SV=3
4	P13195	0.0	743	642	0.634	0.579	HEM1_RAT 5-aminolevulinate synthase, non-specific, mitochondrial OS=Rattus norvegicus OX=10116 GN=Alas1 PE=2 SV=2
5	P13196	0.0	714	640	0.629	0.577	HEM1_HUMAN 5-aminolevulinate synthase, non-specific, mitochondrial OS=Homo sapiens OX=9606 GN=ALAS1 PE=1 SV=2
6	P18080	0.0	530	513	0.487	0.558	HEM0_CHICK 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Gallus gallus OX=9031 GN=ALAS2 PE=2 SV=2
7	P22557	0.0	1225	587	1.000	1.000	HEM0_HUMAN 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Homo sapiens OX=9606 GN=ALAS2 PE=1 SV=2
8	Q5JAM2	0.0	714	640	0.629	0.577	Q5JAM2_HUMAN 5-aminolevulinate synthase OS=Homo sapiens OX=9606 GN=ALAS1 PE=2 SV=1
9	Q63147	0.0	1093	587	0.888	0.888	HEM0_RAT 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Rattus norvegicus OX=10116 GN=Alas2 PE=1 SV=1
10	Q7T2F0	0.0	743	613	0.620	0.594	Q7T2F0_DANRE 5-aminolevulinate synthase OS=Danio rerio OX=7955 GN=wu:fb58d01 PE=1 SV=1
11	Q8T4G6	0.0	558	539	0.475	0.518	Q8T4G6_DROME 5-aminolevulinate synthase OS=Drosophila melanogaster OX=7227 GN=Alas PE=2 SV=1
12	Q8VC19	0.0	727	642	0.639	0.584	HEM1_MOUSE 5-aminolevulinate synthase, non-specific, mitochondrial OS=Mus musculus OX=10090 GN=Alas1 PE=1 SV=2
13	Q9YHT4	0.0	767	583	0.658	0.662	HEM0_DANRE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Danio rerio OX=7955 GN=alas2 PE=2 SV=1
14	A2R9H8	1.10e-141	427	649	0.368	0.333	A2R9H8_ASPNC 5-aminolevulinate synthase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An17g01480 PE=3 SV=1
15	O94069	3.79e-134	404	564	0.336	0.349	HEM1_CANAL 5-aminolevulinate synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HEM1 PE=3 SV=2
16	O14092	9.91e-130	393	558	0.337	0.355	HEM1_SCHPO 5-aminolevulinate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hem1 PE=3 SV=1
17	P09950	6.04e-129	390	548	0.317	0.339	HEM1_YEAST 5-aminolevulinate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEM1 PE=1 SV=1
18	Q8I4X1	4.50e-92	298	630	0.254	0.237	Q8I4X1_PLAF7 5-aminolevulinate synthase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246100 PE=3 SV=1
19	O88986	1.62e-69	232	416	0.228	0.322	KBL_MOUSE 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Mus musculus OX=10090 GN=Gcat PE=1 SV=2
20	O75600	1.22e-66	224	419	0.220	0.308	KBL_HUMAN 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Homo sapiens OX=9606 GN=GCAT PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	1.1e-74	263.4	Aminotransferase class I and II
2	PF00266 Aminotran_5	0.018	25.6	Aminotransferase class-V
3	PF01053 Cys_Met_Meta_PP	0.085	23.0	Cys/Met metabolism PLP-dependent enzyme
4	PF01041 DegT_DnrJ_EryC1	2.8	18.7	DegT/DnrJ/EryC1/StrS aminotransferase family
5	PF09029 Preseq_ALAS	2.1e-07	42.7	5-aminolevulinate synthase presequence

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332369

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386284	0.985	Delta-aminolevulinic acid dehydratase
2	9606.ENSP00000372326	0.953	Ferrochelatase, mitochondrial
3	9606.ENSP00000333667	0.930	Serine hydroxymethyltransferase, mitochondrial
4	9606.ENSP00000318868	0.922	Serine hydroxymethyltransferase, cytosolic
5	9606.ENSP00000262418	0.920	Band 3 anion transport protein
6	9606.ENSP00000317721	0.919	Peroxisomal sarcosine oxidase
7	9606.ENSP00000370737	0.917	Glycine dehydrogenase (decarboxylating), mitochondrial
8	9606.ENSP00000307199	0.916	Alpha-hemoglobin-stabilizing protein
9	9606.ENSP00000300215	0.914	Erythrocyte membrane protein band 4.2
10	9606.ENSP00000228476	0.913	D-amino-acid oxidase
11	9606.ENSP00000302620	0.913	Alanine-glyoxylate aminotransferase
12	9606.ENSP00000231420	0.912	Alanine--glyoxylate aminotransferase 2, mitochondrial
13	9606.ENSP00000360938	0.911	Sarcosine dehydrogenase, mitochondrial
14	9606.ENSP00000379895	0.909	Glycine amidinotransferase, mitochondrial
15	9606.ENSP00000361894	0.907	Glycine N-methyltransferase
16	9606.ENSP00000365858	0.906	Erythroid transcription factor
17	9606.ENSP00000367923	0.900	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
18	9606.ENSP00000328570	0.882	Glutaredoxin-related protein 5, mitochondrial
19	9606.ENSP00000369654	0.878	Hemoglobin subunit delta
20	9606.ENSP00000327431	0.871	Hemoglobin subunit gamma 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016410	1.000	N-acyltransferase activity
GO:0005488	0.997	binding
GO:0003870	0.965	5-aminolevulinate synthase activity
GO:0005515	0.949	protein binding
GO:0043167	0.756	ion binding
GO:0097159	0.696	organic cyclic compound binding
GO:1901363	0.688	heterocyclic compound binding
GO:0036094	0.374	small molecule binding
GO:0043168	0.319	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050896	0.892	response to stimulus
GO:0071704	0.877	organic substance metabolic process
GO:0044237	0.857	cellular metabolic process
GO:0032501	0.772	multicellular organismal process
GO:0006950	0.743	response to stress
GO:0070482	0.731	response to oxygen levels
GO:0032502	0.697	developmental process
GO:0006807	0.677	nitrogen compound metabolic process
GO:0044238	0.624	primary metabolic process
GO:1901564	0.571	organonitrogen compound metabolic process
GO:0048856	0.476	anatomical structure development
GO:0036293	0.441	response to decreased oxygen levels
GO:1901360	0.425	organic cyclic compound metabolic process
GO:0006725	0.416	cellular aromatic compound metabolic process
GO:0065007	0.409	biological regulation
GO:0046483	0.333	heterocycle metabolic process
GO:0009058	0.319	biosynthetic process
GO:0034641	0.310	cellular nitrogen compound metabolic process
GO:1901576	0.306	organic substance biosynthetic process
GO:0044249	0.306	cellular biosynthetic process
GO:0042168	0.301	heme metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.977	intracellular organelle lumen
GO:0016020	0.446	membrane
GO:0005829	0.444	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:12921	0.965	glycine + H(+) + succinyl-CoA = 5-aminolevulinate + CO2 + CoA
EC:2.3.1.37	0.965	5-aminolevulinate synthase.

[back to server]