StarFunc result for job id P22570

User Input

>input (491 residues)
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKH
PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVP
ELREAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAV
ILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKE
LREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASAS
RAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSI
GYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLV
DPQEMLRLLGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A0MSZ4	0.932	0.877	0.000	522	0.984	0.925	A0A0A0MSZ4.pdb.gz	A0A0A0MSZ4_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
2	AFDB:A0A0A0MT64	0.938	0.863	1.210E-103	534	0.998	0.918	A0A0A0MT64.pdb.gz	A0A0A0MT64_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
3	AFDB:P56522	0.954	0.948	5.595E-99	494	0.874	0.868	P56522.pdb.gz	ADRO_RAT NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fdxr PE=1 SV=1
4	AFDB:P08165	0.972	0.970	4.367E-98	492	0.874	0.872	P08165.pdb.gz	ADRO_BOVIN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Bos taurus OX=9913 GN=FDXR PE=1 SV=3
5	AFDB:J3QQX3	0.880	0.933	4.452E-95	463	0.937	0.994	J3QQX3.pdb.gz	J3QQX3_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=2
6	PDB:1e6eA	0.922	0.990	1.972E-88	457	0.825	0.886	1e6eA.pdb.gz	Adrenodoxin Reductase-Adrenodoxin Complex Structure Suggests Electron Transfer Path in Steroid Biosynthesis.
7	AFDB:Q8W3L1	0.875	0.890	2.690E-61	483	0.452	0.460	Q8W3L1.pdb.gz	MFDR_ARATH NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDR PE=1 SV=1
8	AFDB:Q9V3T9	0.864	0.909	8.208E-61	466	0.448	0.472	Q9V3T9.pdb.gz	ADRO_DROME NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=dare PE=2 SV=1
9	PDB:1lqtB	0.849	0.916	1.138E-55	454	0.389	0.421	1lqtB.pdb.gz	A covalent modification of NADP+ revealed by the atomic resolution structure of FprA, a Mycobacterium tuberculosis oxidoreductase.
10	AFDB:O59710	0.855	0.894	3.145E-55	469	0.377	0.394	O59710.pdb.gz	ADRO_SCHPO Probable NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arh1 PE=3 SV=1
11	AFDB:P9WIQ3	0.861	0.925	3.491E-54	456	0.391	0.421	P9WIQ3.pdb.gz	FPRA_MYCTU NADPH-ferredoxin reductase FprA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fprA PE=1 SV=1
12	AFDB:Q54KG7	0.865	0.826	4.301E-52	515	0.356	0.340	Q54KG7.pdb.gz	ADRO_DICDI Probable NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=fdxr PE=3 SV=1
13	PDB:1gthA	0.523	0.264	1.093E-16	1019	0.130	0.063	1gthA.pdb.gz	Crystal structure of the productive ternary complex of dihydropyrimidine dehydrogenase with NADPH and 5-iodouracil. Implications for mechanism of inhibition and electron transfer.
14	PDB:4o5qA	0.323	0.306	2.688E-13	521	0.104	0.098	4o5qA.pdb.gz	Structure, mechanism and ensemble formation of the alkylhydroperoxide reductase subunits AhpC and AhpF from Escherichia coli
15	PDB:3itjB	0.324	0.465	8.695E-13	319	0.108	0.166	3itjB.pdb.gz	Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
16	PDB:2a87A	0.322	0.467	1.978E-12	313	0.134	0.211	2a87A.pdb.gz	Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.
17	PDB:1f6mA	0.417	0.600	1.151E-11	320	0.126	0.194	1f6mA.pdb.gz	Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
18	PDB:3eanD	0.392	0.392	1.736E-11	491	0.128	0.128	3eanD.pdb.gz	Crystal structure and catalysis of the selenoprotein thioredoxin reductase 1.
19	PDB:4g6hA	0.430	0.445	1.952E-11	472	0.116	0.121	4g6hA.pdb.gz	Structural insight into the type-II mitochondrial NADH dehydrogenases.
20	PDB:1ebdA	0.376	0.401	3.122E-11	455	0.112	0.121	1ebdA.pdb.gz	Protein-protein interactions in the pyruvate dehydrogenase multienzyme complex: dihydrolipoamide dehydrogenase complexed with the binding domain of dihydrolipoamide acetyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSZ4	0.0	962	522	0.984	0.925	A0A0A0MSZ4_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
2	A0A0A0MT64	0.0	975	534	0.998	0.918	A0A0A0MT64_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
3	A0A0A0MTN9	0.0	868	439	0.878	0.982	A0A0A0MTN9_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
4	A0A0A0MTR6	0.0	969	483	0.982	0.998	A0A0A0MTR6_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
5	A0A0C4DFN8	0.0	996	491	0.998	0.998	A0A0C4DFN8_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
6	A0A0C4DGN7	0.0	989	497	0.998	0.986	A0A0C4DGN7_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
7	J3QQX3	0.0	917	463	0.939	0.996	J3QQX3_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=2
8	P08165	0.0	853	492	0.874	0.872	ADRO_BOVIN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Bos taurus OX=9913 GN=FDXR PE=1 SV=3
9	P22570	0.0	997	491	1.000	1.000	ADRO_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=3
10	P56522	0.0	850	494	0.874	0.868	ADRO_RAT NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fdxr PE=1 SV=1
11	Q61578	0.0	840	494	0.874	0.868	ADRO_MOUSE NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Mus musculus OX=10090 GN=Fdxr PE=1 SV=1
12	Q9V3T9	6.95e-135	399	466	0.450	0.474	ADRO_DROME NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=dare PE=2 SV=1
13	Q8W3L1	5.25e-128	382	483	0.456	0.464	MFDR_ARATH NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDR PE=1 SV=1
14	O59710	9.74e-105	322	469	0.389	0.407	ADRO_SCHPO Probable NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arh1 PE=3 SV=1
15	P9WIQ3	6.68e-100	309	456	0.391	0.421	FPRA_MYCTU NADPH-ferredoxin reductase FprA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fprA PE=1 SV=1
16	Q54KG7	1.57e-94	297	515	0.356	0.340	ADRO_DICDI Probable NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=fdxr PE=3 SV=1
17	P9WJI1	5.21e-91	290	575	0.391	0.334	FPRB_MYCTU Probable ferredoxin/ferredoxin--NADP reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fprB PE=1 SV=1
18	Q38C21	2.35e-78	258	600	0.356	0.292	Q38C21_TRYB2 Adrenodoxin reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5510 PE=4 SV=1
19	P48360	2.06e-76	249	493	0.354	0.353	ADRO_YEAST Probable NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARH1 PE=1 SV=1
20	Q8VQF5	9.08e-48	173	451	0.299	0.326	CINB_CITBR Cindoxin reductase OS=Citrobacter braakii OX=57706 GN=cinB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01266 DAO	30	15.6	FAD dependent oxidoreductase
2	PF01494 FAD_binding_3	4.4e+02	11.5	FAD binding domain
3	PF03486 HI0933_like	1.4e+02	12.6	HI0933-like protein
4	PF13450 NAD_binding_8	0.024	26.2	NAD(P)-binding Rossmann-like domain
5	PF13454 NAD_binding_9	20	16.7	FAD-NAD(P)-binding
6	PF07992 Pyr_redox_2	9.7e-06	36.6	Pyridine nucleotide-disulphide oxidoreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416515

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260270	0.999	Adrenodoxin, mitochondrial
2	9606.ENSP00000417480	0.986	Bis(5'-adenosyl)-triphosphatase
3	9606.ENSP00000377311	0.984	Ferredoxin-2, mitochondrial
4	9606.ENSP00000268053	0.954	Cholesterol side-chain cleavage enzyme, mitochondrial
5	9606.ENSP00000363205	0.881	Cysteine desulfurase, mitochondrial
6	9606.ENSP00000310623	0.877	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
7	9606.ENSP00000420026	0.859	LYR motif-containing protein 4
8	9606.ENSP00000276449	0.846	Steroidogenic acute regulatory protein, mitochondrial
9	9606.ENSP00000016171	0.815	Cytochrome c oxidase assembly protein COX15 homolog
10	9606.ENSP00000387219	0.807	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
11	9606.ENSP00000216027	0.792	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
12	9606.ENSP00000233893	0.772	10 kDa heat shock protein, mitochondrial
13	9606.ENSP00000365159	0.765	Iron-sulfur cluster assembly 1 homolog, mitochondrial
14	9606.ENSP00000360569	0.764	Non-specific lipid-transfer protein
15	9606.ENSP00000360268	0.760	Delta-1-pyrroline-5-carboxylate synthase
16	9606.ENSP00000366482	0.755	Frataxin, mitochondrial
17	9606.ENSP00000253577	0.742	ATP-binding cassette sub-family B member 7, mitochondrial
18	9606.ENSP00000359211	0.733	Dihydropyrimidine dehydrogenase [NADP(+)]
19	9606.ENSP00000219240	0.728	Dihydroorotate dehydrogenase (quinone), mitochondrial
20	9606.ENSP00000365926	0.728	Riboflavin kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043168	1.000	anion binding
GO:0016731	1.000	oxidoreductase activity, acting on iron-sulfur proteins as donors, NAD or NADP as acceptor
GO:0000166	1.000	nucleotide binding
GO:0005515	0.999	protein binding
GO:0050661	0.991	NADP binding
GO:0050660	0.974	flavin adenine dinucleotide binding
GO:0015039	0.815	NADPH-adrenodoxin reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:1901576	0.972	organic substance biosynthetic process
GO:1901360	0.962	organic cyclic compound metabolic process
GO:0008202	0.925	steroid metabolic process
GO:1901362	0.915	organic cyclic compound biosynthetic process
GO:0006694	0.854	steroid biosynthetic process
GO:0006091	0.836	generation of precursor metabolites and energy
GO:0006807	0.391	nitrogen compound metabolic process
GO:0044281	0.312	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.958	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.18.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
RHEA:42312	0.815	H(+) + NADP(+) + 2 reduced [adrenodoxin] = NADPH + 2 oxidized [adrenodoxin]
EC:1.18.1.6	0.815	adrenodoxin-NADP(+) reductase.

[back to server]