StarFunc result for job id P22607

User Input

>input (806 residues)
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K210	0.436	0.438	0.000	802	0.887	0.892	A0A0G2K210.pdb.gz	A0A0G2K210_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=2
2	AFDB:A4JYQ2	0.427	0.429	0.000	802	0.727	0.731	A4JYQ2.pdb.gz
3	AFDB:F1LSG7	0.550	0.530	0.000	841	0.659	0.631	F1LSG7.pdb.gz	F1LSG7_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
4	AFDB:F8W9L4	0.265	0.270	0.000	792	0.811	0.826	F8W9L4.pdb.gz	F8W9L4_HUMAN Fibroblast growth factor receptor OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
5	AFDB:P11362	0.590	0.580	0.000	822	0.634	0.622	P11362.pdb.gz	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
6	AFDB:P22455	0.412	0.414	0.000	802	0.618	0.621	P22455.pdb.gz	FGFR4_HUMAN Fibroblast growth factor receptor 4 OS=Homo sapiens OX=9606 GN=FGFR4 PE=1 SV=2
7	AFDB:P22607	1.000	1.000	0.000	806	1.000	1.000	P22607.pdb.gz	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
8	AFDB:Q498D6	0.406	0.409	0.000	800	0.600	0.605	Q498D6.pdb.gz	FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1
9	AFDB:Q8JG38	0.412	0.407	0.000	817	0.653	0.644	Q8JG38.pdb.gz	FGFR2_DANRE Fibroblast growth factor receptor 2 OS=Danio rerio OX=7955 GN=fgfr2 PE=1 SV=1
10	AFDB:Q90413	0.557	0.495	0.000	922	0.635	0.555	Q90413.pdb.gz	FGFR4_DANRE Fibroblast growth factor receptor 4 OS=Danio rerio OX=7955 GN=fgfr4 PE=1 SV=1
11	PDB:1k9aB	0.303	0.546	7.179E-26	441	0.138	0.252	1k9aB.pdb.gz
12	PDB:2h8hA	0.289	0.506	1.438E-23	445	0.128	0.231	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.293	0.418	4.762E-21	555	0.130	0.189	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.303	0.437	7.750E-20	551	0.109	0.160	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:2qkwB	0.278	0.715	3.791E-17	292	0.078	0.216	2qkwB.pdb.gz
16	PDB:8dksA	0.253	0.665	6.264E-17	283	0.098	0.279	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:4zhxA	0.287	0.546	1.094E-16	409	0.082	0.161	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:4krcA	0.273	0.698	2.390E-16	297	0.087	0.236	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
19	PDB:1unlA	0.275	0.721	2.527E-16	292	0.072	0.199	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:4c0tA	0.294	0.753	3.532E-16	291	0.068	0.189	4c0tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K210	1422	803	0.876	0.879	A0A0G2K210_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=2
2	A0A8I5Y7R6	1466	782	0.893	0.921	A0A8I5Y7R6_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=3 SV=1
3	F1LN06	987	726	0.598	0.664	F1LN06_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
4	F1LNW0	1048	840	0.656	0.630	F1LNW0_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
5	F1LRU8	984	752	0.593	0.636	F1LRU8_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
6	F1LSG7	1014	841	0.639	0.612	F1LSG7_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
7	F1LSN4	1504	801	0.914	0.920	F1LSN4_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=3
8	F8W9L4	1328	792	0.810	0.824	F8W9L4_HUMAN Fibroblast growth factor receptor OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
9	P11362	1011	822	0.623	0.611	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
10	P16092	1011	822	0.623	0.611	FGFR1_MOUSE Fibroblast growth factor receptor 1 OS=Mus musculus OX=10090 GN=Fgfr1 PE=1 SV=2
11	P21802	1073	821	0.663	0.650	FGFR2_HUMAN Fibroblast growth factor receptor 2 OS=Homo sapiens OX=9606 GN=FGFR2 PE=1 SV=1
12	P21803	1020	821	0.654	0.642	FGFR2_MOUSE Fibroblast growth factor receptor 2 OS=Mus musculus OX=10090 GN=Fgfr2 PE=1 SV=4
13	P21804	1010	819	0.622	0.612	FGFR1_CHICK Fibroblast growth factor receptor 1 OS=Gallus gallus OX=9031 GN=FGFR1 PE=2 SV=1
14	P22455	902	802	0.603	0.606	FGFR4_HUMAN Fibroblast growth factor receptor 4 OS=Homo sapiens OX=9606 GN=FGFR4 PE=1 SV=2
15	P22607	1662	806	1.000	1.000	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
16	Q03142	892	799	0.598	0.603	FGFR4_MOUSE Fibroblast growth factor receptor 4 OS=Mus musculus OX=10090 GN=Fgfr4 PE=1 SV=3
17	Q04589	998	822	0.617	0.605	FGFR1_RAT Fibroblast growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Fgfr1 PE=1 SV=1
18	Q498D6	906	800	0.602	0.606	FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1
19	Q61851	1500	801	0.914	0.920	FGFR3_MOUSE Fibroblast growth factor receptor 3 OS=Mus musculus OX=10090 GN=Fgfr3 PE=1 SV=1
20	Q63240	541	374	0.325	0.701	Q63240_RAT Heparin-binding fibroblast growth factor receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	32	15.1	ABC1 atypical kinase-like domain
2	PF08205 C2-set_2	4.6	18.7	CD80-like C2-set immunoglobulin domain
3	PF07550 DUF1533	6.6e+02	11.6	Protein of unknown function (DUF1533)
4	PF07679 I-set	1.8e-30	116.1	Immunoglobulin I-set domain
5	PF00047 ig	1.1e-17	75.2	Immunoglobulin domain
6	PF13895 Ig_2	2.5e-21	87.1	Immunoglobulin domain
7	PF13927 Ig_3	3.9e-29	112.4	Immunoglobulin domain
8	PF16681 Ig_5	0.0092	27.7	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
9	PF16706 Izumo-Ig	27	16.1	Izumo-like Immunoglobulin domain
10	PF00069 Pkinase	1.4e-40	150.9	Protein kinase domain
11	PF17667 Pkinase_fungal	63	13.8	Fungal protein kinase
12	PF07714 PK_Tyr_Ser-Thr	1.2e-100	347.7	Protein tyrosine and serine/threonine kinase
13	PF07686 V-set	1.2e-08	46.5	Immunoglobulin V-set domain
14	PF08204 V-set_CD47	7.8e+02	11.4	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000027267

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000029676	0.991	Multifunctional fusion protein
2	9598.ENSPTRP00000028196	0.984	Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.
3	9598.ENSPTRP00000009715	0.974	Fibroblast growth factor
4	9598.ENSPTRP00000016382	0.974	Pan troglodytes growth factor receptor-bound protein 2 (GRB2), mRNA
5	9598.ENSPTRP00000005495	0.973	HRas proto-oncogene, GTPase
6	9598.ENSPTRP00000007781	0.967	Uncharacterized protein
7	9598.ENSPTRP00000008150	0.965	Uncharacterized protein
8	9598.ENSPTRP00000051735	0.962	SHC (Src homology 2 domain containing) transforming protein 1
9	9598.ENSPTRP00000023178	0.958	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
10	9598.ENSPTRP00000001956	0.957	Neuroblastoma RAS viral (V-ras) oncogene homolog
11	9598.ENSPTRP00000006877	0.957	Fibroblast growth factor 19
12	9598.ENSPTRP00000026912	0.948	Phosphoinositide-3-kinase, catalytic, alpha polypeptide
13	9598.ENSPTRP00000023137	0.945	Tyrosine-protein kinase
14	9598.ENSPTRP00000028277	0.938	GRB2-associated binding protein 1
15	9598.ENSPTRP00000045123	0.936	Fibroblast growth factor 16
16	9598.ENSPTRP00000028877	0.929	Fibroblast growth factor 10
17	9598.ENSPTRP00000030013	0.929	Uncharacterized protein
18	9598.ENSPTRP00000014330	0.927	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
19	9598.ENSPTRP00000009827	0.926	Uncharacterized protein
20	9598.ENSPTRP00000005056	0.924	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017134	1.000	fibroblast growth factor binding
GO:0005007	1.000	fibroblast growth factor receptor activity
GO:0042802	0.961	identical protein binding
GO:0005102	0.461	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042127	0.996	regulation of cell population proliferation
GO:0007169	0.996	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009719	0.995	response to endogenous stimulus
GO:0048522	0.987	positive regulation of cellular process
GO:0070848	0.985	response to growth factor
GO:0008284	0.983	positive regulation of cell population proliferation
GO:0008543	0.974	fibroblast growth factor receptor signaling pathway
GO:0032502	0.940	developmental process
GO:0048856	0.901	anatomical structure development
GO:0032501	0.897	multicellular organismal process
GO:0007275	0.888	multicellular organism development
GO:0010646	0.871	regulation of cell communication
GO:0071704	0.870	organic substance metabolic process
GO:0023051	0.870	regulation of signaling
GO:0048583	0.850	regulation of response to stimulus
GO:0044237	0.850	cellular metabolic process
GO:0044238	0.844	primary metabolic process
GO:0019222	0.837	regulation of metabolic process
GO:0048731	0.834	system development
GO:0060255	0.819	regulation of macromolecule metabolic process
GO:0009966	0.809	regulation of signal transduction
GO:0048584	0.802	positive regulation of response to stimulus
GO:0080090	0.795	regulation of primary metabolic process
GO:0031323	0.795	regulation of cellular metabolic process
GO:0051171	0.793	regulation of nitrogen compound metabolic process
GO:0006807	0.785	nitrogen compound metabolic process
GO:0009893	0.758	positive regulation of metabolic process
GO:0043170	0.737	macromolecule metabolic process
GO:0065009	0.735	regulation of molecular function
GO:0010647	0.688	positive regulation of cell communication
GO:0023056	0.687	positive regulation of signaling
GO:1902531	0.682	regulation of intracellular signal transduction
GO:0009967	0.680	positive regulation of signal transduction
GO:0048869	0.662	cellular developmental process
GO:0031325	0.644	positive regulation of cellular metabolic process
GO:0010604	0.642	positive regulation of macromolecule metabolic process
GO:1901564	0.641	organonitrogen compound metabolic process
GO:1902533	0.640	positive regulation of intracellular signal transduction
GO:0051173	0.633	positive regulation of nitrogen compound metabolic process
GO:0051246	0.630	regulation of protein metabolic process
GO:0036211	0.630	protein modification process
GO:0042221	0.629	response to chemical
GO:0030154	0.601	cell differentiation
GO:0006796	0.591	phosphate-containing compound metabolic process
GO:0006468	0.572	protein phosphorylation
GO:0048523	0.571	negative regulation of cellular process
GO:0051174	0.571	regulation of phosphorus metabolic process
GO:0048513	0.558	animal organ development
GO:0070887	0.555	cellular response to chemical stimulus
GO:0042325	0.549	regulation of phosphorylation
GO:0010033	0.543	response to organic substance
GO:0051247	0.537	positive regulation of protein metabolic process
GO:0043410	0.529	positive regulation of MAPK cascade
GO:0071310	0.521	cellular response to organic substance
GO:0031399	0.505	regulation of protein modification process
GO:0001932	0.496	regulation of protein phosphorylation
GO:0042327	0.476	positive regulation of phosphorylation
GO:0051239	0.463	regulation of multicellular organismal process
GO:0001934	0.434	positive regulation of protein phosphorylation
GO:0009653	0.427	anatomical structure morphogenesis
GO:0035556	0.397	intracellular signal transduction
GO:0043085	0.377	positive regulation of catalytic activity
GO:0050793	0.362	regulation of developmental process
GO:0016043	0.336	cellular component organization
GO:0007399	0.335	nervous system development
GO:0000165	0.333	MAPK cascade
GO:0007267	0.310	cell-cell signaling
GO:2000026	0.307	regulation of multicellular organismal development
GO:0051240	0.304	positive regulation of multicellular organismal process
GO:0010468	0.300	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.995	intracellular organelle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005634	0.896	nucleus
GO:0016020	0.864	membrane
GO:0071944	0.862	cell periphery
GO:0005886	0.641	plasma membrane
GO:0009986	0.566	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]