StarFunc result for job id P22626

User Input

>input (353 residues)
MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKR
SRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIK
EDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGH
NAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGF
GDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNY
NDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7VJC2	0.607	0.607	1.719E-57	353	0.997	0.997	A7VJC2.pdb.gz	ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus OX=10116 GN=Hnrnpa2b1 PE=1 SV=1
2	AFDB:E7FAQ8	0.552	0.504	8.427E-40	388	0.691	0.629	E7FAQ8.pdb.gz
3	AFDB:A0A024RB53	0.561	0.618	4.795E-39	320	0.601	0.662	A0A024RB53.pdb.gz	A0A024RB53_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:F8VZ49	0.557	0.845	2.525E-35	231	0.442	0.675	F8VZ49.pdb.gz	F8VZ49_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1
5	AFDB:P48810	0.546	0.503	1.180E-32	385	0.479	0.439	P48810.pdb.gz	RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster OX=7227 GN=Hrb87F PE=2 SV=2
6	AFDB:B5X0T7	0.499	0.586	3.392E-32	300	0.487	0.573	B5X0T7.pdb.gz	B5X0T7_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
7	AFDB:Q13151	0.497	0.573	4.326E-31	305	0.470	0.544	Q13151.pdb.gz	ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1
8	AFDB:F1QS28	0.539	0.621	1.407E-30	305	0.496	0.574	F1QS28.pdb.gz	F1QS28_DANRE Heterogeneous nuclear ribonucleoprotein A0 OS=Danio rerio OX=7955 GN=fc01g05 PE=1 SV=1
9	AFDB:P07909	0.507	0.490	1.498E-30	365	0.456	0.441	P07909.pdb.gz	ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster OX=7227 GN=Hrb98DE PE=2 SV=1
10	AFDB:B5X3U2	0.527	0.662	1.696E-30	279	0.448	0.566	B5X3U2.pdb.gz	B5X3U2_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
11	PDB:6y53o	0.209	0.447	1.896E-11	160	0.102	0.225	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
12	PDB:7oqcF	0.212	0.277	5.798E-11	267	0.110	0.146	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:5vsuA	0.252	0.231	2.418E-10	387	0.082	0.075	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
14	PDB:6r5kH	0.208	0.190	7.394E-10	394	0.127	0.114	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
15	PDB:5lsbA	0.203	0.393	2.710E-8	176	0.085	0.170	5lsbA.pdb.gz
16	PDB:7evoD	0.188	0.325	3.265E-8	200	0.088	0.155	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:5yzg1	0.205	0.294	7.788E-8	243	0.093	0.136	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:6y5qq	0.181	0.348	1.062E-7	178	0.085	0.169	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
19	PDB:6ff7X	0.198	0.392	5.681E-7	171	0.082	0.170	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:5xjcw	0.216	0.759	2.227E-6	91	0.065	0.253	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7VJC2	0.0	687	353	0.997	0.997	ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus OX=10116 GN=Hnrnpa2b1 PE=1 SV=1
2	O88569	0.0	688	353	0.997	0.997	ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus OX=10090 GN=Hnrnpa2b1 PE=1 SV=2
3	P22626	0.0	690	353	1.000	1.000	ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2
4	A0A087WUI2	1.41e-146	416	261	0.552	0.747	A0A087WUI2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=1
5	I6L957	1.73e-135	387	249	0.513	0.727	I6L957_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=1
6	F8W6I7	1.03e-118	347	307	0.572	0.658	F8W6I7_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=2
7	F8VZ49	1.61e-109	321	231	0.408	0.623	F8VZ49_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1
8	Q0VAC0	2.19e-107	318	320	0.550	0.606	Q0VAC0_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRPA1 PE=2 SV=1
9	A0A024RB53	3.69e-107	318	320	0.550	0.606	A0A024RB53_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
10	P49312	3.69e-107	318	320	0.550	0.606	ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus OX=10090 GN=Hnrnpa1 PE=1 SV=2
11	P09651	5.43e-107	320	372	0.408	0.387	ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5
12	P04256	1.35e-106	317	320	0.547	0.603	ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus OX=10116 GN=Hnrnpa1 PE=1 SV=3
13	B4DDB6	3.58e-106	317	356	0.405	0.402	B4DDB6_HUMAN Heterogeneous nuclear ribonucleoprotein A3, isoform CRA_a OS=Homo sapiens OX=9606 GN=HNRPA3 PE=2 SV=1
14	A0A384NL63	9.24e-106	317	378	0.405	0.378	A0A384NL63_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=HNRPA3 PE=2 SV=1
15	P51991	9.24e-106	317	378	0.405	0.378	ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2
16	Q6URK4	9.54e-106	317	379	0.405	0.377	ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus OX=10116 GN=Hnrnpa3 PE=1 SV=1
17	Q7SXQ3	1.36e-98	299	388	0.382	0.348	Q7SXQ3_DANRE Heterogeneous nuclear ribonucleoprotein A1 OS=Danio rerio OX=7955 GN=hnrnpa1a PE=1 SV=1
18	P48810	1.79e-71	229	385	0.280	0.257	RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster OX=7227 GN=Hrb87F PE=2 SV=2
19	P07909	2.12e-71	228	365	0.289	0.279	ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster OX=7227 GN=Hrb98DE PE=2 SV=1
20	Q22037	6.80e-70	224	346	0.295	0.301	ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans OX=6239 GN=hrp-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08206 OB_RNB	1.2e+02	13.8	Ribonuclease B OB domain
2	PF00076 RRM_1	1.4e-28	109.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	5e-07	41.1	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010626562.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010631133.1	0.993	Heterogeneous nuclear ribonucleoprotein L isoform X1
2	885580.XP_010618541.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
3	885580.XP_010603981.1	0.977	Heterogeneous nuclear ribonucleoprotein M
4	885580.XP_010633268.1	0.977	Polypyrimidine tract-binding protein 1
5	885580.XP_010636133.1	0.975	Heterogeneous nuclear ribonucleoproteins C1/C2 isoform X1
6	885580.XP_010624289.1	0.965	Heterogeneous nuclear ribonucleoprotein R
7	885580.XP_010633012.1	0.961	Belongs to the CTL (choline transporter-like) family.
8	885580.XP_010631224.1	0.953	Heterogeneous nuclear ribonucleoprotein K
9	885580.XP_010640991.1	0.953	Heterogeneous nuclear ribonucleoprotein U
10	885580.XP_010607678.1	0.951	Heterogeneous nuclear ribonucleoprotein A1
11	885580.XP_010635515.1	0.951	Heterogeneous nuclear ribonucleoprotein K
12	885580.XP_010622511.1	0.944	Transformer-2 protein homolog beta
13	885580.XP_010637127.1	0.941	Serine/arginine-rich splicing factor 3
14	885580.XP_010607967.1	0.939	Poly(RC)-binding protein 1
15	885580.XP_010616942.1	0.936	THO complex subunit 4
16	885580.XP_010612902.1	0.935	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome.
17	885580.XP_010612457.1	0.933	Heterogeneous nuclear ribonucleoprotein A0
18	885580.XP_010607954.1	0.931	Small nuclear ribonucleoprotein G isoform X1
19	885580.XP_010612090.1	0.931	Matrin-3
20	885580.XP_010627472.1	0.928	Small nuclear ribonucleoprotein F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003729	0.998	mRNA binding
GO:0005515	0.996	protein binding
GO:0003677	0.861	DNA binding
GO:0003730	0.720	mRNA 3'-UTR binding
GO:0019899	0.507	enzyme binding
GO:0003697	0.409	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.986	regulation of biological process
GO:0071704	0.982	organic substance metabolic process
GO:0044237	0.980	cellular metabolic process
GO:0010468	0.979	regulation of gene expression
GO:0044238	0.977	primary metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0043170	0.960	macromolecule metabolic process
GO:0050794	0.958	regulation of cellular process
GO:0010467	0.942	gene expression
GO:0046483	0.941	heterocycle metabolic process
GO:0006725	0.937	cellular aromatic compound metabolic process
GO:1901360	0.935	organic cyclic compound metabolic process
GO:0034641	0.935	cellular nitrogen compound metabolic process
GO:0006139	0.919	nucleobase-containing compound metabolic process
GO:0090304	0.890	nucleic acid metabolic process
GO:0048519	0.867	negative regulation of biological process
GO:0080090	0.861	regulation of primary metabolic process
GO:0051171	0.861	regulation of nitrogen compound metabolic process
GO:0031323	0.855	regulation of cellular metabolic process
GO:0016070	0.793	RNA metabolic process
GO:0006396	0.750	RNA processing
GO:0050658	0.716	RNA transport
GO:0009892	0.635	negative regulation of metabolic process
GO:0019219	0.635	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.588	regulation of RNA metabolic process
GO:0010605	0.545	negative regulation of macromolecule metabolic process
GO:0048523	0.502	negative regulation of cellular process
GO:0048518	0.448	positive regulation of biological process
GO:0008380	0.432	RNA splicing
GO:0031326	0.430	regulation of cellular biosynthetic process
GO:0010556	0.429	regulation of macromolecule biosynthetic process
GO:0048522	0.410	positive regulation of cellular process
GO:0010604	0.406	positive regulation of macromolecule metabolic process
GO:0016071	0.386	mRNA metabolic process
GO:0006397	0.348	mRNA processing
GO:0051173	0.347	positive regulation of nitrogen compound metabolic process
GO:0031325	0.321	positive regulation of cellular metabolic process
GO:0000398	0.315	mRNA splicing, via spliceosome
GO:0050896	0.301	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.996	membrane-enclosed lumen
GO:0005654	0.992	nucleoplasm
GO:0032991	0.954	protein-containing complex
GO:0005829	0.946	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]