StarFunc result for job id P22670

User Input

>input (979 residues)
MATQAYTELQAAPPPSQPPQAPPQAQPQPPPPPPPAAPQPPQPPTAAATPQPQYVTELQS
PQPQAQPPGGQKQYVTELPAVPAPSQPTGAPTPSPAPQQYIVVTVSEGAMRASETVSEAS
PGSTASQTGVPTQVVQQVQGTQQRLLVQTSVQAKPGHVSPLQLTNIQVPQQALPTQRLVV
QSAAPGSKGGQVSLTVHGTQQVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQS
VPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPHVYSSQVQYVEG
GDASYTASAIRSSTYSYPETPLYTQTASTSYYEAAGTATQVSTPATSQAVASSGSMPMYV
SGSQVVASSTSTGAGASNSSGGGGSGGGGGGGGGGGGGGSGSTGGGGSGAGTYVIQGGYM
LGSASQSYSHTTRASPATVQWLLDNYETAEGVSLPRSTLYCHYLLHCQEQKLEPVNAASF
GKLIRSVFMGLRTRRLGTRGNSKYHYYGLRIKASSPLLRLMEDQQHMAMRGQPFSQKQRL
KPIQKMEGMTNGVAVGQQPSTGLSDISAQVQQYQQFLDASRSLPDFTELDLQGKVLPEGV
GPGDIKAFQVLYREHCEAIVDVMVNLQFTLVETLWKTFWRYNLSQPSEAPPLAVHDEAEK
RLPKAILVLLSKFEPVLQWTKHCDNVLYQGLVEILIPDVLRPIPSALTQAIRNFAKSLES
WLTHAMVNIPEEMLRVKVAAAGAFAQTLRRYTSLNHLAQAARAVLQNTAQINQMLSDLNR
VDFANVQEQASWVCRCEDRVVQRLEQDFKVTLQQQNSLEQWAAWLDGVVSQVLKPYQGSA
GFPKAAKLFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMYYLIEHRVAQAKGE
TPIAVMGEFANLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGESPALGPETLEPP
AKLARTDARGLFVQALPSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22670	1.000	1.000	0.000	979	1.000	1.000	P22670.pdb.gz	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
2	AFDB:Q86SQ0	0.049	0.041	3.148E-4	1253	0.135	0.105	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
3	AFDB:Q8K1N2	0.054	0.041	1.259E-3	1249	0.143	0.112	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
4	AFDB:O08815	0.051	0.044	1.314E-3	1206	0.128	0.104	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
5	AFDB:Q80XI3	0.068	0.052	2.116E-3	1579	0.162	0.101	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
6	AFDB:Q8IN89	0.087	0.087	2.517E-3	984	0.146	0.145	Q8IN89.pdb.gz	Q8IN89_DROME Well-rounded, isoform B OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
7	AFDB:O43432	0.069	0.051	3.408E-3	1585	0.173	0.107	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
8	AFDB:X2JAX8	0.071	0.059	4.419E-3	1330	0.125	0.092	X2JAX8.pdb.gz	X2JAX8_DROME Nostrin, isoform H OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
9	AFDB:O54988	0.054	0.051	4.615E-3	1233	0.122	0.097	O54988.pdb.gz	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
10	AFDB:Q68CQ1	0.096	0.076	5.984E-3	1323	0.109	0.081	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
11	PDB:7qsoN	0.080	0.178	5.724E-1	347	0.031	0.086	7qsoN.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
12	PDB:5xjt2	0.048	0.152	9.218E-1	217	0.038	0.171	5xjt2.pdb.gz	Structures of 7S mutant complexes
13	PDB:6tejB	0.081	0.121	9.626E-1	585	0.052	0.087	6tejB.pdb.gz	The ABC exporter IrtAB imports and reduces mycobacterial siderophores.
14	PDB:3qf4B	0.062	0.084	1.303	588	0.045	0.075	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
15	PDB:7oixB	0.096	0.158	1.421	451	0.055	0.120	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
16	PDB:7blnA	0.069	0.079	1.484	769	0.055	0.070	7blnA.pdb.gz
17	PDB:7zh0A	0.074	0.113	1.484	495	0.045	0.089	7zh0A.pdb.gz
18	PDB:7dl9A	0.073	0.130	1.550	405	0.043	0.104	7dl9A.pdb.gz
19	PDB:5lzrB	0.086	0.108	1.765	697	0.031	0.043	5lzrB.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
20	PDB:5mkkB	0.062	0.090	1.843	577	0.037	0.062	5mkkB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2GV50	0.0	767	692	0.415	0.587	RFX2_RAT DNA-binding protein RFX2 OS=Rattus norvegicus OX=10116 GN=Rfx2 PE=1 SV=1
2	P22670	0.0	1971	979	1.000	1.000	RFX1_HUMAN MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2
3	P48377	0.0	1535	963	0.869	0.884	RFX1_MOUSE MHC class II regulatory factor RFX1 OS=Mus musculus OX=10090 GN=Rfx1 PE=1 SV=2
4	P48378	0.0	745	723	0.417	0.564	RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens OX=9606 GN=RFX2 PE=1 SV=2
5	P48379	0.0	745	717	0.409	0.558	RFX2_MOUSE DNA-binding protein RFX2 OS=Mus musculus OX=10090 GN=Rfx2 PE=1 SV=2
6	P48380	0.0	818	749	0.418	0.546	RFX3_HUMAN Transcription factor RFX3 OS=Homo sapiens OX=9606 GN=RFX3 PE=1 SV=2
7	P48381	0.0	815	749	0.416	0.543	RFX3_MOUSE Transcription factor RFX3 OS=Mus musculus OX=10090 GN=Rfx3 PE=1 SV=2
8	Q32NR3	0.0	758	694	0.395	0.558	RFX2_XENLA DNA-binding protein RFX2 OS=Xenopus laevis OX=8355 GN=rfx2 PE=2 SV=1
9	Q5EAP5	0.0	756	734	0.414	0.552	RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio OX=7955 GN=rfx2 PE=2 SV=1
10	A0A0B4K621	1.18e-171	525	860	0.275	0.313	A0A0B4K621_DROME Rfx, isoform G OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
11	A0A0B4K6P1	2.65e-171	525	911	0.275	0.295	A0A0B4K6P1_DROME Rfx, isoform C OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
12	A0A0B4KFL4	6.31e-171	523	882	0.275	0.305	A0A0B4KFL4_DROME Rfx, isoform F OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
13	A0A0B4K653	4.07e-165	509	919	0.282	0.300	A0A0B4K653_DROME Rfx, isoform H OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
14	Q9U1K2	1.40e-164	507	897	0.281	0.307	Q9U1K2_DROME RFX transcription factor OS=Drosophila melanogaster OX=7227 GN=Rfx PE=2 SV=1
15	A8JQX0	1.89e-164	507	889	0.282	0.310	A8JQX0_DROME Rfx, isoform I OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
16	Q9VGZ6	5.48e-164	506	897	0.282	0.308	Q9VGZ6_DROME Rfx, isoform J OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=2
17	Q7TNK1	1.23e-88	301	735	0.186	0.248	RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus OX=10090 GN=Rfx4 PE=1 SV=1
18	Q33E94	1.47e-88	301	735	0.183	0.244	RFX4_HUMAN Transcription factor RFX4 OS=Homo sapiens OX=9606 GN=RFX4 PE=1 SV=2
19	A2BGA0	6.74e-88	299	735	0.178	0.237	RFX4_DANRE Transcription factor RFX4 OS=Danio rerio OX=7955 GN=rfx4 PE=2 SV=1
20	Q5RJA1	1.14e-76	271	848	0.173	0.199	RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio OX=7955 GN=rfx6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04589 RFX1_trans_act	2.4e-70	247.4	RFX1 transcription activation region
2	PF02257 RFX_DNA_binding	3.6e-29	112.5	RFX DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387699	0.963	Cyclic AMP-responsive element-binding protein 1
2	9606.ENSP00000362649	0.945	Histone deacetylase 1
3	9606.ENSP00000485010	0.922	MHC class II transactivator
4	9606.ENSP00000305071	0.910	DNA-binding protein RFXANK
5	9606.ENSP00000255476	0.832	Regulatory factor X-associated protein
6	9606.ENSP00000262510	0.829	Protein NLRC5
7	9606.ENSP00000428085	0.765	Ribosomal protein L30
8	9606.ENSP00000396843	0.758	Nuclear factor 1 C-type
9	9606.ENSP00000323580	0.739	Intraflagellar transport protein 88 homolog
10	9606.ENSP00000323880	0.733	Forkhead box protein J1
11	9606.ENSP00000328352	0.662	BTB/POZ domain-containing protein KCTD11
12	9606.ENSP00000479618	0.619	Myc proto-oncogene protein
13	9606.ENSP00000319883	0.603	Adhesion G protein-coupled receptor E2
14	9606.ENSP00000356575	0.603	Transcription factor HIVEP2
15	9606.ENSP00000466718	0.581	LSM12 homolog
16	9606.ENSP00000260570	0.580	Intraflagellar transport protein 172 homolog
17	9606.ENSP00000374529	0.568	Cyclin-K
18	9606.ENSP00000426359	0.556	Multicilin
19	9606.ENSP00000264758	0.551	Alpha-adducin
20	9606.ENSP00000343741	0.547	Serine/threonine-protein kinase ATR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000981	0.980	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.341	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.978	biological regulation
GO:0050794	0.961	regulation of cellular process
GO:0080090	0.880	regulation of primary metabolic process
GO:0051171	0.880	regulation of nitrogen compound metabolic process
GO:0031323	0.878	regulation of cellular metabolic process
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0009987	0.874	cellular process
GO:0019219	0.868	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.858	regulation of DNA-templated transcription
GO:0048518	0.744	positive regulation of biological process
GO:0050896	0.742	response to stimulus
GO:0048522	0.627	positive regulation of cellular process
GO:0002376	0.545	immune system process
GO:0009893	0.545	positive regulation of metabolic process
GO:0051173	0.499	positive regulation of nitrogen compound metabolic process
GO:0010604	0.499	positive regulation of macromolecule metabolic process
GO:0031325	0.459	positive regulation of cellular metabolic process
GO:0045935	0.369	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.364	regulation of transcription by RNA polymerase II
GO:0045893	0.362	positive regulation of DNA-templated transcription
GO:0045944	0.300	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.557	cytoplasm
GO:0032991	0.447	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]