StarFunc result for job id P22680

User Input

>input (504 residues)
MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQ
RKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGN
TTENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMF
EAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAE
SLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQ
MIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKESLRLSSAS
LNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTK
TTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLD
QSRAGLGILPPLNDIEFKYKFKHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22680	1.000	1.000	3.365E-91	504	1.000	1.000	P22680.pdb.gz	CP7A1_HUMAN Cytochrome P450 7A1 OS=Homo sapiens OX=9606 GN=CYP7A1 PE=1 SV=2
2	AFDB:P18125	0.993	0.995	1.346E-80	503	0.823	0.825	P18125.pdb.gz	CP7A1_RAT Cytochrome P450 7A1 OS=Rattus norvegicus OX=10116 GN=Cyp7a1 PE=1 SV=1
3	PDB:3v8dA	0.929	0.978	3.400E-79	479	0.940	0.990	3v8dA.pdb.gz	Crystal structure of human CYP7A1 in complex with 7-ketocholesterol
4	AFDB:Q60991	0.907	0.902	1.222E-47	507	0.383	0.381	Q60991.pdb.gz	CP7B1_MOUSE Cytochrome P450 7B1 OS=Mus musculus OX=10090 GN=Cyp7b1 PE=1 SV=2
5	AFDB:O75881	0.905	0.901	6.684E-46	506	0.399	0.397	O75881.pdb.gz	CP7B1_HUMAN Cytochrome P450 7B1 OS=Homo sapiens OX=9606 GN=CYP7B1 PE=1 SV=2
6	AFDB:O02766	0.907	0.914	6.039E-45	500	0.359	0.362	O02766.pdb.gz	CP8B1_RABIT 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Oryctolagus cuniculus OX=9986 GN=CYP8B1 PE=1 SV=3
7	AFDB:O88962	0.916	0.923	1.047E-44	500	0.331	0.334	O88962.pdb.gz	CP8B1_MOUSE 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Mus musculus OX=10090 GN=Cyp8b1 PE=1 SV=1
8	AFDB:Q7YRB2	0.902	0.907	2.994E-44	501	0.345	0.347	Q7YRB2.pdb.gz	CP8B1_PIG 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase OS=Sus scrofa OX=9823 GN=CYP8B1 PE=1 SV=1
9	AFDB:Q9UNU6	0.893	0.898	8.559E-44	501	0.335	0.337	Q9UNU6.pdb.gz	CP8B1_HUMAN 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Homo sapiens OX=9606 GN=CYP8B1 PE=1 SV=2
10	AFDB:G3V8J2	0.898	0.907	1.215E-43	499	0.335	0.339	G3V8J2.pdb.gz	G3V8J2_RAT Cytochrome P450 family 8 subfamily B member 1 OS=Rattus norvegicus OX=10116 GN=Cyp8b1 PE=1 SV=1
11	AFDB:Q29626	0.908	0.915	1.482E-42	500	0.323	0.326	Q29626.pdb.gz	PTGIS_BOVIN Prostacyclin synthase OS=Bos taurus OX=9913 GN=PTGIS PE=1 SV=1
12	PDB:2iagA	0.842	0.898	1.521E-41	471	0.315	0.338	2iagA.pdb.gz	Crystal Structure of the Human Prostacyclin Synthase
13	PDB:7lyxA	0.842	0.930	5.862E-40	455	0.321	0.356	7lyxA.pdb.gz	The structure and characterization of human cytochrome P450 8B1 supports future drug design for nonalcoholic fatty liver disease and diabetes.
14	PDB:3b98A	0.786	0.883	4.324E-37	446	0.292	0.330	3b98A.pdb.gz	Structures of Prostacyclin Synthase and Its Complexes with Substrate Analog and Inhibitor Reveal a Ligand-specific Heme Conformation Change
15	PDB:3b99B	0.760	0.916	7.110E-35	415	0.288	0.349	3b99B.pdb.gz	Structures of Prostacyclin Synthase and Its Complexes with Substrate Analog and Inhibitor Reveal a Ligand-specific Heme Conformation Change
16	PDB:5eqbA	0.720	0.686	5.451E-24	531	0.218	0.207	5eqbA.pdb.gz	Architecture of a single membrane spanning cytochrome P450 suggests constraints that orient the catalytic domain relative to a bilayer.
17	PDB:5jlcA	0.705	0.703	3.300E-23	506	0.220	0.219	5jlcA.pdb.gz	Crystal Structures of Full-Length Lanosterol 14 alpha-Demethylases of Prominent Fungal Pathogens Candida albicans and Candida glabrata Provide Tools for Antifungal Discovery.
18	PDB:5v5zA	0.738	0.759	1.998E-22	488	0.192	0.199	5v5zA.pdb.gz	Crystal Structures of Full-Length Lanosterol 14 alpha-Demethylases of Prominent Fungal Pathogens Candida albicans and Candida glabrata Provide Tools for Antifungal Discovery.
19	PDB:4bjkA	0.673	0.745	1.898E-21	450	0.185	0.207	4bjkA.pdb.gz	Rational Development of 4-Aminopyridyl-Based Inhibitors Targeting Trypanosoma Cruzi Cyp51 as Anti-Chagas Agents.
20	PDB:1e9xA	0.712	0.791	8.514E-21	449	0.179	0.200	1e9xA.pdb.gz	Crystal Structure of Cytochrome P450 14Alpha -Sterol Demethylase (Cyp51) from Mycobacterium Tuberculosis in Complex with Azole Inhibitors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18125	0.0	890	503	0.823	0.825	CP7A1_RAT Cytochrome P450 7A1 OS=Rattus norvegicus OX=10116 GN=Cyp7a1 PE=1 SV=1
2	P22680	0.0	1055	504	1.000	1.000	CP7A1_HUMAN Cytochrome P450 7A1 OS=Homo sapiens OX=9606 GN=CYP7A1 PE=1 SV=2
3	Q64505	0.0	889	503	0.815	0.817	CP7A1_MOUSE Cytochrome P450 7A1 OS=Mus musculus OX=10090 GN=Cyp7a1 PE=2 SV=2
4	O75881	5.10e-117	355	506	0.391	0.389	CP7B1_HUMAN Cytochrome P450 7B1 OS=Homo sapiens OX=9606 GN=CYP7B1 PE=1 SV=2
5	O02766	3.53e-106	327	500	0.363	0.366	CP8B1_RABIT 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Oryctolagus cuniculus OX=9986 GN=CYP8B1 PE=1 SV=3
6	Q60991	1.06e-101	316	507	0.365	0.363	CP7B1_MOUSE Cytochrome P450 7B1 OS=Mus musculus OX=10090 GN=Cyp7b1 PE=1 SV=2
7	Q9UNU6	2.29e-100	313	501	0.351	0.353	CP8B1_HUMAN 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Homo sapiens OX=9606 GN=CYP8B1 PE=1 SV=2
8	Q7YRB2	1.16e-99	311	501	0.371	0.373	CP8B1_PIG 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase OS=Sus scrofa OX=9823 GN=CYP8B1 PE=1 SV=1
9	Q9WVT5	4.28e-99	309	499	0.349	0.353	Q9WVT5_RAT Sterol 12alpha-hydroxylase P450 OS=Rattus norvegicus OX=10116 GN=Cyp8b1 PE=2 SV=1
10	O88962	1.05e-96	303	500	0.349	0.352	CP8B1_MOUSE 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Mus musculus OX=10090 GN=Cyp8b1 PE=1 SV=1
11	G3V8J2	4.63e-95	299	499	0.355	0.359	G3V8J2_RAT Cytochrome P450 family 8 subfamily B member 1 OS=Rattus norvegicus OX=10116 GN=Cyp8b1 PE=1 SV=1
12	Q63688	5.65e-84	267	414	0.310	0.377	CP7B1_RAT 25-hydroxycholesterol 7-alpha-hydroxylase (Fragment) OS=Rattus norvegicus OX=10116 GN=Cyp7b1 PE=1 SV=1
13	F1RE08	2.08e-81	263	480	0.317	0.333	PTGIS_DANRE Prostacyclin synthase OS=Danio rerio OX=7955 GN=ptgis PE=1 SV=1
14	Q16647	1.00e-80	261	500	0.319	0.322	PTGIS_HUMAN Prostacyclin synthase OS=Homo sapiens OX=9606 GN=PTGIS PE=1 SV=1
15	O35074	9.00e-80	259	501	0.317	0.319	PTGIS_MOUSE Prostacyclin synthase OS=Mus musculus OX=10090 GN=Ptgis PE=1 SV=1
16	Q62969	7.94e-79	256	501	0.313	0.315	PTGIS_RAT Prostacyclin synthase OS=Rattus norvegicus OX=10116 GN=Ptgis PE=2 SV=1
17	Q29626	1.78e-73	243	500	0.306	0.308	PTGIS_BOVIN Prostacyclin synthase OS=Bos taurus OX=9913 GN=PTGIS PE=1 SV=1
18	F1SBE5	3.09e-70	234	492	0.300	0.307	F1SBE5_PIG Prostaglandin I2 synthase OS=Sus scrofa OX=9823 GN=PTGIS PE=1 SV=3
19	Q9JKJ9	7.40e-34	135	470	0.252	0.270	CP39A_MOUSE 24-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus OX=10090 GN=Cyp39a1 PE=1 SV=1
20	Q9NYL5	2.37e-28	119	469	0.214	0.230	CP39A_HUMAN 24-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens OX=9606 GN=CYP39A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	1.2e-98	342.6	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301645

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258415	0.988	Sterol 26-hydroxylase, mitochondrial
2	9606.ENSP00000447149	0.988	Bile acid receptor
3	9606.ENSP00000297679	0.976	3 beta-hydroxysteroid dehydrogenase type 7
4	9606.ENSP00000360918	0.971	Cholesterol 25-hydroxylase
5	9606.ENSP00000385523	0.971	Peroxisome proliferator-activated receptor alpha
6	9606.ENSP00000261835	0.965	Cholesterol 24-hydroxylase
7	9606.ENSP00000445122	0.964	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
8	9606.ENSP00000358421	0.953	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
9	9606.ENSP00000369050	0.951	Cytochrome P450 1A1
10	9606.ENSP00000342007	0.950	Cytochrome P450 1A2
11	9606.ENSP00000419692	0.949	Retinoic acid receptor RXR-alpha
12	9606.ENSP00000217971	0.946	Membrane-associated progesterone receptor component 1
13	9606.ENSP00000358903	0.946	Steroid 17-alpha-hydroxylase/17,20 lyase
14	9606.ENSP00000201586	0.942	Sulfotransferase family cytosolic 2B member 1
15	9606.ENSP00000347717	0.932	7-dehydrocholesterol reductase
16	9606.ENSP00000337915	0.930	Cytochrome P450 3A4
17	9606.ENSP00000217964	0.926	F-box-like/WD repeat-containing protein TBL1X
18	9606.ENSP00000440689	0.924	Cytochrome P450 2E1
19	9606.ENSP00000385216	0.923	Nuclear receptor coactivator 1
20	9606.ENSP00000480571	0.918	Cytochrome P450 3A7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008395	1.000	steroid hydroxylase activity
GO:0016709	0.996	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0005488	0.679	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:1901615	0.994	organic hydroxy compound metabolic process
GO:0008202	0.992	steroid metabolic process
GO:0009987	0.990	cellular process
GO:0044281	0.990	small molecule metabolic process
GO:0065007	0.985	biological regulation
GO:0044237	0.984	cellular metabolic process
GO:0050789	0.978	regulation of biological process
GO:0050794	0.954	regulation of cellular process
GO:1901576	0.918	organic substance biosynthetic process
GO:0016125	0.915	sterol metabolic process
GO:0044283	0.905	small molecule biosynthetic process
GO:0006694	0.896	steroid biosynthetic process
GO:0006082	0.879	organic acid metabolic process
GO:0043436	0.859	oxoacid metabolic process
GO:0019216	0.847	regulation of lipid metabolic process
GO:0032787	0.847	monocarboxylic acid metabolic process
GO:1901617	0.843	organic hydroxy compound biosynthetic process
GO:0044249	0.822	cellular biosynthetic process
GO:0046890	0.820	regulation of lipid biosynthetic process
GO:0062012	0.812	regulation of small molecule metabolic process
GO:0019218	0.762	regulation of steroid metabolic process
GO:0050810	0.732	regulation of steroid biosynthetic process
GO:0072330	0.697	monocarboxylic acid biosynthetic process
GO:0031323	0.677	regulation of cellular metabolic process
GO:0050896	0.651	response to stimulus
GO:0048518	0.519	positive regulation of biological process
GO:0010565	0.506	regulation of cellular ketone metabolic process
GO:0051716	0.482	cellular response to stimulus
GO:0042221	0.434	response to chemical
GO:0048522	0.370	positive regulation of cellular process
GO:0009893	0.324	positive regulation of metabolic process
GO:0006066	0.317	alcohol metabolic process
GO:0031326	0.310	regulation of cellular biosynthetic process
GO:0048878	0.301	chemical homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.995	endomembrane system
GO:0016020	0.942	membrane
GO:0031090	0.861	organelle membrane
GO:0005783	0.794	endoplasmic reticulum
GO:0031984	0.757	organelle subcompartment
GO:0005789	0.747	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:43836	1.000	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)
EC:1.14.13.-	0.996	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.

[back to server]